"PAPPA" Related Products

Expand
Expand

Recombinant Human PAPPA, StrepII-tagged

Cat.No.: PAPPA-226H
Product Overview: Purified, full-length human recombinant Pappalysin-1 preproprotein or PAPPA protein (amino acids 82-621, 540 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 60.8 kDa. (Accession NP_002572; UniProt Q13219)
Description: PAPPA is a metalloproteinase which cleaves insulin-like growth factor binding proteins (IGFBPs). It is thought to be involved in local proliferative processes such as wound healing and bone remodeling. Low plasma level of this protein has been suggested as a biochemical marker for pregnancies with aneuploid fetuses. It belongs to the peptidase M43B family. Contains 5 Sushi (CCP/SCR) domains.
Source: Human Cells
Species: Human
Tag: StrepII
Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
Protein length: 82-621, 540 a.a.
AA Sequence: EARGATEEPSPPSRALYFSGRGEQLRLRADLELPRDAFTLQVWLRAEGGQRSPAVITGLYDKCSYISRDRGWVVG IHTISDQDNKDPRYFFSLKTDRARQVTTINAHRSYLPGQWVYLAATYDGQFMKLYVNGAQVATSGEQVGGIFSPL TQKCKVLMLGGSALNHNYRGYIEHFSLWKVARTQREILSDMETHGAHTALPQLLLQENWDNVKHAWSPMKDGSSP KVEFSNAHGFLLDTSLEPPLCGQTLCDNTEVIASYNQLSSFRQPKVVRYRVVNLYEDDHKNPTVTREQVDFQHHQ LAEAFKQYNISWELDVLEVSNSSLRRRLILANCDISKIGDENCDPECNHTLTGHDGGDCRHLRHPAFVKKQHNGV CDMDCNYERFNFDGGECCDPEITNVTQTCFDPDSPHRAYLDVNELKNILKLDGSTHLNIFFAKSSEEELAGVATW PWDKEALMHLGGIVLNPSFYGMPGHTHTMIHEIGHSLGLYHVFRGISEIQSCSDPCMETEPSFETGDLCNDTNPA PKHKSCGDPGPGNDT
Endotoxin: <0.1 eu per ug protein by lal
Purity: >95% pure by SDS-PAGE
Storage: 12 months at -20°Cas supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.
Gene Name: PAPPA pregnancy-associated plasma protein A, pappalysin 1 [ Homo sapiens ]
Official Symbol: PAPPA
Synonyms: PAPPA; pregnancy-associated plasma protein A, pappalysin 1; pappalysin-1; ASBABP2; aspecific BCL2 ARE binding protein 2; differentially placenta 1 expressed protein; DIPLA1; IGFBP 4ase; insulin like growth factor dependent IGF binding protein 4 protease; PAPA; PAPP A; PAPPA1; IGF-dependent IGFBP-4 protease; aspecific BCL2 ARE-binding protein 2; pregnacy-associated plasma protein A; insulin-like growth factor-dependent IGF binding protein-4 protease; insulin-like growth factor-dependent IGF-binding protein 4 protease; PAPP-A; IGFBP-4ase;
Gene ID: 5069
mRNA Refseq: NM_002581
Protein Refseq: NP_002572
MIM: 176385
UniProt ID: Q13219
Chromosome Location: 9q33.1
Pathway: Diabetes pathways, organism-specific biosystem; Disease, organism-specific biosystem; Regulation of Insulin-like Growth Factor (IGF) Activity by Insulin-like Growth Factor Binding Proteins (IGFBPs), organism-specific biosystem;
Function: endopeptidase activity; metal ion binding; metallopeptidase activity; metallopeptidase activity; peptidase activity; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.