Recombinant Human MLH1, StrepII-tagged MLH1-233H

Cat.No.:	MLH1-233H
Product Overview:	Purified human recombinant DNA mismatch repair MLH1 protein (amino acids 410-652, 243 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 27.4 kDa. (Accession NP_000240.1; UniProt P40692)
Description:	This product is a fragment of MLH1, which is a component of the post-replicative DNA mismatch repair system (MMR). It is a human homolog of the E. coli DNA mismatch repair gene mutL. Native MLH1 heterodimerizes with MLH3 to form MutL gamma, which plays a role in meiosis.
Source:	Human Cells
Species:	Human
Tag:	StrepII
Form:	Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
Protein length:	410-652, 243 a.a.
AA Sequence:	AIVTEDKTDISSGRARQQDEEMLELPAPAEVAAKNQSLEGDTTKGTSEMSEKRGPTSSNPRKRHREDSDVEMVED DSRKEMTAACTPRRRIINLTSVLSLQEEINEQGHEVLREMLHNHSFVGCVNPQWALAQHQTKLYLLNTTKLSEEL FYQILIYDFANFGVLRLSEPAPLFDLAMLALDSPESGWTEEDGPKEGLAEYIVEFLKKKAEMLADYFSLEIDEEG NLIGLPLLIDNYVPPLEG
Endotoxin:	<0.1 eu per ug protein by lal
Purity:	>95% pure by SDS-PAGE
Storage:	12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
Reconstitution:	Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.

Download Datasheet

Gene Name:	MLH1 mutL homolog 1, colon cancer, nonpolyposis type 2 (E. coli) [ Homo sapiens ]
Official Symbol:	MLH1
Synonyms:	MLH1; mutL homolog 1, colon cancer, nonpolyposis type 2 (E. coli); COCA2, mutL (E. coli) homolog 1 (colon cancer, nonpolyposis type 2); DNA mismatch repair protein Mlh1; FCC2; HNPCC; HNPCC2; COCA2; hMLH1; MGC5172;
Gene ID:	4292
mRNA Refseq:	NM_000249
Protein Refseq:	NP_000240
MIM:	120436
UniProt ID:	P40692
Chromosome Location:	3p22.3
Pathway:	BRCA1-associated genome surveillance complex (BASC), organism-specific biosystem; Colorectal cancer, organism-specific biosystem; Colorectal cancer, conserved biosystem; Direct p53 effectors, organism-specific biosystem; Endometrial cancer, organism-specific biosystem; Endometrial cancer, conserved biosystem; Fanconi anemia pathway, organism-specific biosystem;
Function:	ATP binding; ATPase activity; contributes_to MutSalpha complex binding; guanine/thymine mispair binding; mismatched DNA binding; protein binding; contributes_to protein binding; contributes_to single-stranded DNA binding;