Recombinant Human CD4, StrepII-tagged

Cat.No.: CD4-234H
Product Overview: Purified human recombinant T-cell surface glycoprotein CD4 protein (amino acids 26-396, 371 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 41.3 kDa. (Accession NP_000607.1; UniProt P01730)
Description: This product is the extracellular domain of CD4, a membrane glycoprotein of T lymphocytes that interacts with major histocompatibility complex class II antigens and is also a receptor for the human immunodeficiency virus.
Source: Human Cells
Species: Human
Tag: StrepII
Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
Protein length: 26-396, 371 a.a.
AA Sequence: KKVVLGKKGDTVELTCTASQKKSIQFHWKNSNQIKILGNQGSFLTKGPSKLNDRADSRRSLWDQGNFPLIIKNLK IEDSDTYICEVEDQKEEVQLLVFGLTANSDTHLLQGQSLTLTLESPPGSSPSVQCRSPRGKNIQGGKTLSVSQLE LQDSGTWTCTVLQNQKKVEFKIDIVVLAFQKASSIVYKKEGEQVEFSFPLAFTVEKLTGSGELWWQAERASSSKS WITFDLKNKEVSVKRVTQDPKLQMGKKLPLHLTLPQALPQYAGSGNLTLALEAKTGKLHQEVNLVVMRATQLQKN LTCEVWGPTSPKLMLSLKLENKEAKVSKREKAVWVLNPEAGMWQCLLSDSGQVLLESNIKVLPTWSTPVQP
Endotoxin: <0.1 eu per ug protein by lal
Purity: >80% pure by SDS-PAGE
Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.
Gene Name: CD4 CD4 molecule [ Homo sapiens ]
Official Symbol: CD4
Synonyms: CD4; CD4 molecule; CD4 antigen (p55) , T cell surface glycoprotein CD4; T-cell surface glycoprotein CD4; CD4 receptor; CD4 antigen (p55); T-cell surface antigen T4/Leu-3; CD4mut;
Gene ID: 920
mRNA Refseq: NM_000616
Protein Refseq: NP_000607
MIM: 186940
UniProt ID: P01730
Chromosome Location: 12p13.31
Pathway: Adaptive Immune System, organism-specific biosystem; Alpha-defensins, organism-specific biosystem; Antigen processing and presentation, organism-specific biosystem; Antigen processing and presentation, conserved biosystem; Arf1 pathway, organism-specific biosystem; Binding and entry of HIV virion, organism-specific biosystem; C-MYB transcription factor network, organism-specific biosystem;
Function: MHC class II protein binding; coreceptor activity; enzyme binding; extracellular matrix structural constituent; glycoprotein binding; protein binding; protein homodimerization activity; protein kinase binding; receptor activity; transmembrane signaling receptor activity; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.