"CD79A" Related Products

Expand

Recombinant Human CD79A, StrepII-tagged

Cat.No.: CD79A-240H
Product Overview: Purified human recombinant CD79a or B-cell antigen receptor protein (amino acids 33-116, 84 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 9.5 kDa. (Accession NP_001774.1; UniProt P11912)
Description: This product is the extracellular domain of the CD79 alpha chain. CD79A is required in cooperation with CD79B for initiation of the signal transduction cascade activated by binding of antigen to the B-cell antigen receptor complex (BCR), which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. It is Also required for BCR surface expression and for efficient differentiation of pro- and pre-B-cells.
Source: Human Cells
Species: Human
Tag: StrepII
Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
Protein length: 33-116, 84 a.a.
AA Sequence: LWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCR VQEGNESYQ
Endotoxin: <0.1 eu per ug protein by lal
Purity: >80% pure by SDS-PAGE
Storage: 12 months at -20°C as supplied; 1 month at °C after reconstitution. Avoid freeze/thaw cycles.
Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.
Gene Name: CD79A CD79a molecule, immunoglobulin-associated alpha [ Homo sapiens ]
Official Symbol: CD79A
Synonyms: CD79A; CD79a molecule, immunoglobulin-associated alpha; CD79A antigen (immunoglobulin associated alpha) , IGA; B-cell antigen receptor complex-associated protein alpha chain; MB 1; ig-alpha; MB-1 membrane glycoprotein; surface IgM-associated protein; CD79a antigen (immunoglobulin-associated alpha); membrane-bound immunoglobulin-associated protein; IGA; MB-1;
Gene ID: 973
mRNA Refseq: NM_001783
Protein Refseq: NP_001774
MIM: 112205
UniProt ID: P11912
Chromosome Location: 19q13.2
Pathway: Adaptive Immune System, organism-specific biosystem; Antigen Activates B Cell Receptor Leading to Generation of Second Messengers, organism-specific biosystem; B Cell Receptor Signaling Pathway, organism-specific biosystem; B cell receptor signaling pathway, organism-specific biosystem; B cell receptor signaling pathway, conserved biosystem; BCR signaling pathway, organism-specific biosystem; Immune System, organism-specific biosystem;
Function: transmembrane signaling receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.