"WNT16" Related Products

Expand
Expand

Recombinant Human WNT16, StrepII-tagged

Cat.No.: WNT16-243H
Product Overview: Purified, full-length human recombinant WNT16 protein (amino acids 30-365, 336 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 37.6 kDa. (Accession NP_476509.1; UniProt Q9UBV4)
Description: Wnt16 is a ligand for members of the frizzled family of seven transmembrane receptors. It may be a signaling molecule which affects the development of discrete regions of tissues. The protein Is likely to signal over only few cell diameters.
Source: Human Cells
Species: Human
Tag: StrepII
Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
Protein length: 30-365, 336 a.a.
AA Sequence: NWMWLGIASFGVPEKLGCANLPLNSRQKELCKRKPYLLPSIREGARLGIQECGSQFRHERWNCMITAAATTAPMGASPLFGYELSSGTKE TAFIYAVMAAGLVHSVTRSCSAGNMTECSCDTTLQNGGSASEGWHWGGCSDDVQYGMWFSRKFLDFPIGNTTGKENKVLLAMNLHNNEAGRQAVA KLMSVDCRCHGVSGSCAVKTCWKTMSSFEKIGHLLKDKYENSIQISDKTKRKMRRREKDQRKIPIHKDDLLYVNKSPNYCVEDKKLGIPGTQGRECNRTSE GADGCNLLCCGRGYNTHVVRHVERCECKFIWCCYVRCRRCESMTDVHTCK
Endotoxin: <0.1 eu per ug protein by lal
Purity: >95% pure by SDS-PAGE
Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.
Gene Name: WNT16 wingless-type MMTV integration site family, member 16 [ Homo sapiens ]
Official Symbol: WNT16
Synonyms: WNT16; wingless-type MMTV integration site family, member 16; protein Wnt-16; wingless-type MMTV integration site family member 16b;
Gene ID: 51384
mRNA Refseq: NM_016087
Protein Refseq: NP_057171
MIM: 606267
UniProt ID: Q9UBV4
Chromosome Location: 7q31
Pathway: Basal cell carcinoma, organism-specific biosystem; Basal cell carcinoma, conserved biosystem; Class B/2 (Secretin family receptors), organism-specific biosystem; DNA damage response (only ATM dependent), organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; HTLV-I infection, organism-specific biosystem; HTLV-I infection, conserved biosystem;
Function: frizzled binding; receptor binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.