"FGF1" Related Products

Recombinant Human FGF1, StrepII-tagged

Cat.No.: FGF1-244H
Product Overview: Purified, full-length human recombinant FGF1 or Acidic fibroblast growth factor protein (amino acids 16-155, 140 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 15.8 kDa. (Accession NP_000791.1; UniProt P05230)
Description: FGF1 is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth, and invasion. This protein functions as a modifier of endothelial cell migration and proliferation, as well as an angiogenic factor. It acts as a mitogen for a variety of mesoderm- and neuroectoderm-derived cells in vitro, thus is thought to be involved in organogenesis. Multiple alternatively spliced variants encoding different isoforms have been described.
Source: Human Cells
Species: Human
Tag: StrepII
Form: Lyophilized from sterile 0.2|ìm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
Protein length: 16-155, 140 a.a.
AA Sequence: FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYI SKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Endotoxin: <0.1 eu per ug protein by lal
Purity: >95% pure by SDS-PAGE
Storage: 12 months at -20??C as supplied; 1 month at 4??C after reconstitution. Avoid freeze/thaw cycles.
Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.
Gene Name: FGF1 fibroblast growth factor 1 (acidic) [ Homo sapiens ]
Official Symbol: FGF1
Synonyms: FGF1; fibroblast growth factor 1 (acidic); FGFA; fibroblast growth factor 1; AFGF; ECGF; ECGF beta; ECGFA; ECGFB; endothelial cell growth factor; alpha; beta; FGF alpha; GLIO703; HBGF1; heparin binding growth factor 1; heparin-binding growth factor 1; beta-endothelial cell growth factor; endothelial cell growth factor, beta; endothelial cell growth factor, alpha; FGF-1; HBGF-1; ECGF-beta; FGF-alpha;
Gene ID: 2246
mRNA Refseq: NM_000800
Protein Refseq: NP_000791
MIM: 131220
UniProt ID: P05230
Chromosome Location: 5q31.3-q33.2
Pathway: Downstream signaling of activated FGFR, organism-specific biosystem; FGF signaling pathway, organism-specific biosystem; FGFR ligand binding and activation, organism-specific biosystem; FGFR1 ligand binding and activation, organism-specific biosystem; FGFR1b ligand binding and activation, organism-specific biosystem; FGFR1c ligand binding and activation, organism-specific biosystem; FGFR2 ligand binding and activation, organism-specific biosystem;
Function: S100 alpha binding; fibroblast growth factor receptor binding; growth factor activity; heparin binding; protein binding; protein tyrosine kinase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.