Recombinant Human CSF3, StrepII-tagged CSF3-250H

Recombinant Human CSF3, StrepII-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human CSF3, StrepII-tagged

Recombinant Human CSF3, StrepII-tagged

CSF3 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : CSF3-250H
Product Overview : Purified, full-length human recombinant G-CSF or Granulocyte colony-stimulating factor protein (amino acids 30-207, 178 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 19.1 kDa. (Accession NP_000750.1; UniProt P09919)
Description : Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes- macrophages. This CSF induces granulocytes.
Source : Human Cells
Species : Human
Tag : StrepII
Form : Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
Protein length : 30-207, 178 a.a.
AA Sequence : ATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLVSECATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGI SPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
Endotoxin : <0.1 eu per ug protein by lal
Purity : >80% pure by SDS-PAGE
Storage : 12 months at -20°C as supplied; 1 month at °C after reconstitution. Avoid freeze/thaw cycles.
Reconstitution : Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.
Gene Name : CSF3 colony stimulating factor 3 (granulocyte) [ Homo sapiens ]
Official Symbol : CSF3
Synonyms : CSF3; colony stimulating factor 3 (granulocyte); C17orf33, chromosome 17 open reading frame 33 , G CSF, GCSF; granulocyte colony-stimulating factor; filgrastim; granulocyte colony stimulating factor; lenograstim; MGC45931; pluripoietin; GCSF; CSF3OS; C17orf33;
Gene ID : 1440
mRNA Refseq : NM_000759
Protein Refseq : NP_000750
MIM : 138970
UniProt ID : P09919
Chromosome Location : 17q11.2-q12
Pathway : Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Cytokines and Inflammatory Response, organism-specific biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem;
Function : cytokine activity; cytokine activity; enzyme binding; granulocyte colony-stimulating factor receptor binding; growth factor activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy