Recombinant Human EPO, StrepII-tagged EPO-252H

Recombinant Human EPO, StrepII-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human EPO, StrepII-tagged

Recombinant Human EPO, StrepII-tagged

EPO Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : EPO-252H
Product Overview : Purified, full-length human recombinant EPO or Erythropoietin protein (amino acids 28-193, 166 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 18.4 kDa. (Accession NP_000790.2; UniProt P01588)
Description : Erythropoietin (EPO) is the principal hormone involved in the regulation of erythrocyte differentiation and the maintenance of a physiological level of circulating erythrocyte mass.
Source : Human Cells
Species : Human
Tag : StrepII
Form : Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
Protein length : 28-193, 166 a.a.
AA Sequence : APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHV DKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR
Endotoxin : <0.1 eu per ug protein by lal
Purity : >80% pure by SDS-PAGE
Storage : 12 months at -20°C as supplied; 1 month at °C after reconstitution. Avoid freeze/thaw cycles.
Reconstitution : Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.
Gene Name : EPO erythropoietin [ Homo sapiens ]
Official Symbol : EPO
Synonyms : EPO; erythropoietin; EP; epoetin; MVCD2; MGC138142;
Gene ID : 2056
mRNA Refseq : NM_000799
Protein Refseq : NP_000790
MIM : 133170
UniProt ID : P01588
Chromosome Location : 7q21
Pathway : Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; EPO Receptor Signaling, organism-specific biosystem; EPO signaling pathway, organism-specific biosystem; HIF-1-alpha transcription factor network, organism-specific biosystem; HIF-2-alpha transcription factor network, organism-specific biosystem; Hematopoietic cell lineage, organism-specific biosystem;
Function : erythropoietin receptor binding; eukaryotic cell surface binding; hormone activity; protein binding; protein kinase activator activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy