"EPO" Related Products

Expand
Expand

Recombinant Human EPO, StrepII-tagged

Cat.No.: EPO-252H
Product Overview: Purified, full-length human recombinant EPO or Erythropoietin protein (amino acids 28-193, 166 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 18.4 kDa. (Accession NP_000790.2; UniProt P01588)
Description: Erythropoietin (EPO) is the principal hormone involved in the regulation of erythrocyte differentiation and the maintenance of a physiological level of circulating erythrocyte mass.
Source: Human Cells
Species: Human
Tag: StrepII
Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
Protein length: 28-193, 166 a.a.
AA Sequence: APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHV DKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR
Endotoxin: <0.1 eu per ug protein by lal
Purity: >80% pure by SDS-PAGE
Storage: 12 months at -20°C as supplied; 1 month at °C after reconstitution. Avoid freeze/thaw cycles.
Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.
Gene Name: EPO erythropoietin [ Homo sapiens ]
Official Symbol: EPO
Synonyms: EPO; erythropoietin; EP; epoetin; MVCD2; MGC138142;
Gene ID: 2056
mRNA Refseq: NM_000799
Protein Refseq: NP_000790
MIM: 133170
UniProt ID: P01588
Chromosome Location: 7q21
Pathway: Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; EPO Receptor Signaling, organism-specific biosystem; EPO signaling pathway, organism-specific biosystem; HIF-1-alpha transcription factor network, organism-specific biosystem; HIF-2-alpha transcription factor network, organism-specific biosystem; Hematopoietic cell lineage, organism-specific biosystem;
Function: erythropoietin receptor binding; eukaryotic cell surface binding; hormone activity; protein binding; protein kinase activator activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.