"FLT3LG" Related Products

Recombinant Human FLT3LG, StrepII-tagged

Cat.No.: FLT3LG-254H
Product Overview: Purified, full-length human recombinant FLT3L or Fms-related tyrosine kinase 3 ligand protein (amino acids 27-235, 209 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 23.7 kDa. (Accession NP_001450; UniProt P49771)
Description: Flt3L, a homodimer, stimulates the proliferation of early hematopoietic cells by activating FLT3. It synergizes well with a number of other colony stimulating factors and interleukins.
Source: Human Cells
Species: Human
Tag: StrepII
Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
Protein length: 27-235, 209 a.a.
AA Sequence: TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRF VQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQPPLLLLLLLPVGLLLLAAAWCLHWQRTRRRTPRPGEQVPPVPSPQD LLLVE
Endotoxin: <0.1 eu per ug protein by lal
Purity: >90% pure by SDS-PAGE
Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.
Gene Name: FLT3LG fms-related tyrosine kinase 3 ligand [ Homo sapiens ]
Official Symbol: FLT3LG
Synonyms: FLT3LG; fms-related tyrosine kinase 3 ligand; flt3 ligand; FL; FLT3L;
Gene ID: 2323
mRNA Refseq: NM_001204502
Protein Refseq: NP_001191431
MIM: 600007
UniProt ID: P49771
Chromosome Location: 19q13.3
Pathway: Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; Pathways in cancer, organism-specific biosystem;
Function: cytokine activity; protein homodimerization activity; receptor binding; receptor tyrosine kinase binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.