Recombinant Human IFNG, StrepII-tagged IFNG-257H

Recombinant Human IFNG, StrepII-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human IFNG, StrepII-tagged

Recombinant Human IFNG, StrepII-tagged

IFNG Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : IFNG-257H
Product Overview : Purified, full-length human recombinant IFNG or Interferon gamma protein (amino acids 24-161, 138 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 16.2 kDa. (Accession NP_000610.2; UniProt P01579)
Description : IFNG is produced by lymphocytes activated by specific antigens or mitogens. In addition to having antiviral activity, it has important immunoregulatory functions. It is a potent activator of macrophages, has antiproliferative effects on transformed cells, and can potentiate the antiviral and antitumor effects of the type I interferons. It belongs to the type II (or gamma) interferon family.
Source : Human Cells
Species : Human
Tag : StrepII
Form : Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
Protein length : 24-161, 138 a.a.
AA Sequence : QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLT NYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ
Endotoxin : <0.1 eu per ug protein by lal
Purity : >80% pure by SDS-PAGE
Storage : 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
Reconstitution : Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.
Gene Name : IFNG interferon, gamma [ Homo sapiens ]
Official Symbol : IFNG
Synonyms : IFNG; interferon, gamma; interferon gamma; IFN-gamma; immune interferon; IFG; IFI;
Gene ID : 3458
mRNA Refseq : NM_000619
Protein Refseq : NP_000610
MIM : 147570
UniProt ID : P01579
Chromosome Location : 12q14
Pathway : ATF-2 transcription factor network, organism-specific biosystem; African trypanosomiasis, organism-specific biosystem; African trypanosomiasis, conserved biosystem; Allograft rejection, organism-specific biosystem; Allograft rejection, conserved biosystem; Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem;
Function : cytokine activity; interferon-gamma receptor binding;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy