"OSM" Related Products

Expand
Expand
Expand

Recombinant Human OSM, StrepII-tagged

Cat.No.: OSM-259H
Product Overview: Purified, full-length human recombinant OSM or Oncostatin-M protein (amino acids 26-220, 195 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 22 kDa. (Accession NP_065391.1; UniProt P13725)
Description: Oncostatin M (OSM) is a member of a cytokine family that includes leukemia-inhibitory factor, granulocyte colony-stimulating factor, and interleukin 6. This gene encodes a growth regulator which inhibits the proliferation of a number of tumor cell lines. It regulates cytokine production, including IL-6, G-CSF and GM-CSF from endothelial cells.
Source: Human Cells
Species: Human
Tag: StrepII
Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
Protein length: 26-220, 195 a.a.
AA Sequence: AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQD LERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRRHSPHQ ALRKGVRRTRPSRKGKRLMTRGQLPR
Endotoxin: <0.1 eu per ug protein by lal
Purity: >80% pure by SDS-PAGE
Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.
Gene Name: OSM oncostatin M [ Homo sapiens ]
Official Symbol: OSM
Synonyms: OSM; oncostatin M; oncostatin-M; MGC20461;
Gene ID: 5008
mRNA Refseq: NM_020530
Protein Refseq: NP_065391
MIM: 165095
UniProt ID: P13725
Chromosome Location: 22q12.2
Pathway: Adipogenesis, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem;
Function: cytokine activity; growth factor activity; oncostatin-M receptor binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.