"SPP1" Related Products

Expand
Expand
Expand

Recombinant Human SPP1, StrepII-tagged

Cat.No.: SPP1-260H
Product Overview: Purified, full-length human recombinant OSTP (SPP1) or Osteopontin protein (amino acids 17-314, 298 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 33.7 kDa. (Accession NP_001035149.1; UniProt P10451)
Description: Osteopontin is involved in the attachment of osteoclasts to the mineralized bone matrix. It is secreted and binds hydroxyapatite with high affinity. This protein is also a cytokine that upregulates expression of interferon-gamma and interleukin-12.
Source: Human Cells
Species: Human
Tag: StrepII
Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
Protein length: 17-314, 298 a.a.
AA Sequence: IPVKQADSGSSEEKQLYNKYPDAVATWLNPDPSQKQNLLAPQNAVSSEETNDFKQETLPSKSNESHDHMDDMDDEDDDDHVDSQDSID SNDSDDVDDTDDSHQSDESHHSDESDELVTDFPTDLPATEVFTPVVPTVDTYDGRGDSVVYGLRSKSKKFRRPDIQYPDATDEDITSHMESEELNGAYKAI PVAQDLNAPSDWDSRGKDSYETSQLDDQSAETHSHKQSRLYKRKANDESNEHSDVIDSQELSKVSREFHSHEFHSHEDMLVVDPKSKEEDKHLKFRISHE LDSASSEVN
Endotoxin: <0.1 eu per ug protein by lal
Purity: >95% pure by SDS-PAGE
Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.
Gene Name: SPP1 secreted phosphoprotein 1 [ Homo sapiens ]
Official Symbol: SPP1
Synonyms: SPP1; secreted phosphoprotein 1; BNSP, bone sialoprotein I , OPN, osteopontin; osteopontin; BSPI; early T lymphocyte activation 1; ETA 1; uropontin; nephropontin; osteopontin-C; osteopontin-D; SPP1/CALPHA1 fusion; bone sialoprotein 1; urinary stone protein; early T-lymphocyte activation 1; osteopontin/immunoglobulin alpha 1 heavy chain constant region fusion protein; secreted phosphoprotein 1 (osteopontin, bone sialoprotein I, early T-lymphocyte activation 1); OPN; BNSP; ETA-1; MGC110940;
Gene ID: 6696
mRNA Refseq: NM_000582
Protein Refseq: NP_000573
MIM: 166490
UniProt ID: P10451
Chromosome Location: 4q22.1
Pathway: Direct p53 effectors, organism-specific biosystem; ECM-receptor interaction, organism-specific biosystem; ECM-receptor interaction, conserved biosystem; Endochondral Ossification, organism-specific biosystem; FGF signaling pathway, organism-specific biosystem; Focal Adhesion, organism-specific biosystem; Focal adhesion, organism-specific biosystem;
Function: cytokine activity; extracellular matrix binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.