"PRL" Related Products

Recombinant Human PRL, StrepII-tagged

Cat.No.: PRL-261H
Product Overview: Purified, full-length human recombinant PRL or Prolactin protein (amino acids 29-227, 199 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 22.9 kDa. (Accession NP_000939.1; UniProt P01236)
Description: Prolactin is an anterior pituitary hormone. It is a growth regulator for many tissues, including cells of the immune system. It may also play a role in cell survival by suppressing apoptosis, and it is essential for lactation.
Source: Human Cells
Species: Human
Tag: StrepII
Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
Protein length: 29-227, 199 a.a.
AA Sequence: MNIKGSPWKGSLLLLLVSNLLLCQSVAPLPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKE QAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRR DSHKIDNYLKLLKCRIIHNNNC
Endotoxin: <0.1 eu per ug protein by lal
Purity: >95% pure by SDS-PAGE
Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.
Gene Name: PRL prolactin [ Homo sapiens ]
Official Symbol: PRL
Synonyms: PRL; prolactin; decidual prolactin;
Gene ID: 5617
mRNA Refseq: NM_000948
Protein Refseq: NP_000939
MIM: 176760
UniProt ID: P01236
Chromosome Location: 6p22.2-p21.3
Pathway: Amyloids, organism-specific biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Disease, organism-specific biosystem; ErbB4 signaling events, organism-specific biosystem; Glucocorticoid receptor regulatory network, organism-specific biosystem;
Function: hormone activity; prolactin receptor binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.