Recombinant Human IL6, StrepII-tagged

Cat.No.: IL6-264H
Product Overview: Purified, full-length human recombinant IL6 or Interleukin 6 protein (amino acids 30-212, 183 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 23.7 kDa. (Accession NP_000591.1; UniProt P05231)
Description: IL6 is a cytokine with a wide variety of biological functions. It is a potent inducer of the acute phase response. It plays an essential role in the final differentiation of B-cells into Ig-secreting cells and is involved in lymphocyte and monocyte differentiation. In addition, it induces myeloma and plasmacytoma growth and nerve cells differentiation. IL6 acts on B-cells, T-cells, hepatocytes, hematopoietic progenitor cells and cells of the CNS as well as a myokine. It is discharged into the bloodstream after muscle contraction and acts to increase the breakdown of fats and to improve insulin resistance.
Source: Human Cells
Species: Human
Tag: StrepII
Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
Protein length: 30-212, 183 a.a.
AA Sequence: VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEY LQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Endotoxin: <0.1 eu per ug protein by lal
Purity: >95% pure by SDS-PAGE
Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.
Gene Name: IL6 interleukin 6 (interferon, beta 2) [ Homo sapiens ]
Official Symbol: IL6
Synonyms: IL6; interleukin 6 (interferon, beta 2); IFNB2; interleukin-6; BSF2; HGF; HSF; IL 6; CDF; BSF-2; IFN-beta-2; interferon beta-2; interleukin BSF-2; hybridoma growth factor; CTL differentiation factor; B-cell stimulatory factor 2; B-cell differentiation factor; IL-6;
Gene ID: 3569
mRNA Refseq: NM_000600
Protein Refseq: NP_000591
MIM: 147620
UniProt ID: P05231
Chromosome Location: 7p21-p15
Pathway: ATF-2 transcription factor network, organism-specific biosystem; Adipogenesis, organism-specific biosystem; African trypanosomiasis, organism-specific biosystem; African trypanosomiasis, conserved biosystem; Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem;
Function: cytokine activity; cytokine activity; growth factor activity; interleukin-6 receptor binding; contributes_to interleukin-6 receptor binding; interleukin-6 receptor binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.