"WNT3A" Related Products

Expand
Expand

Recombinant Human WNT3A, StrepII-tagged

Cat.No.: WNT3A-265H
Product Overview: Purified, full-length human recombinant WNT3A protein (amino acids 19-352, 334 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 37.4 kDa. (Accession NP_149122.1; UniProt P56704)
Description: WNT3A is a member of the WNT gene family. It plays distinct roles in cell-cell signaling during morphogenesis of the developing neural tube. Palmitoylation at Ser-209 is required for efficient binding to frizzled receptors. It is also required for subsequent palmitoylation at Cys-77. Palmitoylation is necessary for proper trafficking to cell surface.
Source: Human Cells
Species: Human
Tag: StrepII
Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
Protein length: 19-352, 334 a.a.
AA Sequence: SYPIWWSLAVGPQYSSLGSQPILCASIPGLVPKQLRFCRNYVEIMPSVAEGIKIGIQECQHQFRGRRWNCTTVHD SLAIFGPVLDKATRESAFVHAIASAGVAFAVTRSCAEGTAAICGCSSRHQGSPGKGWKWGGCSEDIEFGGMVSRE FADARENRPDARSAMNRHNNEAGRQAIASHMHLKCKCHGLSGSCEVKTCWWSQPDFRAIGDFLKDKYDSASEMVV EKHRESRGWVETLRPRYTYFKVPTERDLVYYEASPNFCEPNPETGSFGTRDRTCNVSSHGIDGCDLLCCGRGHNA RAERRREKCRCVFHWCCYVSCQECTRVYDVHTCK
Endotoxin: <0.1 eu per ug protein by lal
Purity: >80% by SDS-PAGE
Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.
Gene Name: WNT3A wingless-type MMTV integration site family, member 3A [ Homo sapiens ]
Official Symbol: WNT3A
Synonyms: WNT3A; wingless-type MMTV integration site family, member 3A; protein Wnt-3a; MGC119418; MGC119419; MGC119420;
Gene ID: 89780
mRNA Refseq: NM_033131
Protein Refseq: NP_149122
MIM: 606359
UniProt ID: P56704
Chromosome Location: 1q42
Pathway: Basal cell carcinoma, organism-specific biosystem; Basal cell carcinoma, conserved biosystem; Canonical Wnt signaling pathway, organism-specific biosystem; Class B/2 (Secretin family receptors), organism-specific biosystem; DNA damage response (only ATM dependent), organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; HTLV-I infection, organism-specific biosystem;
Function: extracellular matrix structural constituent; frizzled-2 binding; protein binding; protein domain specific binding; receptor agonist activity; transcription coactivator activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.