"IL10" Related Products

Recombinant Human IL10, StrepII-tagged

Cat.No.: IL10-267H
Product Overview: Purified, full-length human recombinant IL10 protein (amino acids 19-178, 160 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 18.6 kDa. (Accession NP_000563; UniProt P22301)
Description: IL10 is a cytokine produced primarily by monocytes and, to a lesser extent, by lymphocytes. IL10 has pleiotropic effects in immunoregulation and inflammation. It down-regulates the expression of Th1 cytokines, MHC class II Ags, and costimulatory molecules on macrophages. It also enhances B cell survival, proliferation, and antibody production. This cytokine can block NF-kappa B activity, and is involved in the regulation of the JAK-STAT signaling pathway. It belongs to the IL10 family.
Source: Human Cells
Species: Human
Tag: StrepII
Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
Protein length: 19-178, 160 a.a.
AA Sequence: MHSSALLCCLVLLTGVRASPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFK GYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQ EKGIYKAMSEFDIFINYIEAYMTMKIRN
Endotoxin: <0.1 eu per ug protein by lal
Purity: >80% by SDS-PAGE
Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.
Gene Name: IL10 interleukin 10 [ Homo sapiens ]
Official Symbol: IL10
Synonyms: IL10; interleukin 10; interleukin-10; CSIF; cytokine synthesis inhibitory factor; IL 10; IL10A; T cell growth inhibitory factor; TGIF; T-cell growth inhibitory factor; GVHDS; IL-10; MGC126450; MGC126451;
Gene ID: 3586
mRNA Refseq: NM_000572
Protein Refseq: NP_000563
MIM: 124092
UniProt ID: P22301
Chromosome Location: 1q31-q32
Pathway: African trypanosomiasis, organism-specific biosystem; African trypanosomiasis, conserved biosystem; Allograft rejection, organism-specific biosystem; Allograft rejection, conserved biosystem; Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; Asthma, organism-specific biosystem;
Function: cytokine activity; growth factor activity; interleukin-10 receptor binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.