"IL5" Related Products

Expand
Expand

Recombinant Human IL5, StrepII-tagged

Cat.No.: IL5-269H
Product Overview: Purified, full-length human recombinant IL5 protein (amino acids 20-134, 115 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 15.2 kDa. (Accession NP_000870; UniProt P05113)
Description: IL5 is a cytokine that acts as a growth and differentiation factor for both B cells and eosinophils. This cytokine is a main regulator of eosinopoiesis, eosinophil maturation and activation. The elevated production of this cytokine is reported to be related to asthma or hypereosinophilic syndromes. The receptor of this cytokine is a heterodimer, whose beta subunit is shared with the receptors for IL3 and colony stimulating factor 2 (CSF2/GM-CSF).
Source: Human Cells
Species: Human
Tag: StrepII
Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
Protein length: 20-134, 115 a.a.
AA Sequence: IPTEIPTSALVKETLALLSTHRTLLIANETLRIPVPVHKNHQLCTEEIFQGIGTLESQTVQGGTVERLFKNLSLI KKYIDGQKKKCGEERRRVNQFLDYLQEFLGVMNTEWIIES
Endotoxin: <0.1 eu per ug protein by lal
Purity: >80~90%% by SDS-PAGE
Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.
Gene Name: IL5 interleukin 5 (colony-stimulating factor, eosinophil) [ Homo sapiens ]
Official Symbol: IL5
Synonyms: IL5; interleukin 5 (colony-stimulating factor, eosinophil); interleukin-5; B cell differentiation factor I; EDF; eosinophil differentiation factor; IL 5; interleukin 5; T cell replacing factor; TRF; T-cell replacing factor; B-cell differentiation factor I; IL-5;
Gene ID: 3567
mRNA Refseq: NM_000879
Protein Refseq: NP_000870
MIM: 147850
UniProt ID: P05113
Chromosome Location: 5q23-q31
Pathway: Allograft rejection, organism-specific biosystem; Allograft rejection, conserved biosystem; Asthma, organism-specific biosystem; Asthma, conserved biosystem; Autoimmune thyroid disease, organism-specific biosystem; Autoimmune thyroid disease, conserved biosystem; Calcineurin-regulated NFAT-dependent transcription in lymphocytes, organism-specific biosystem;
Function: cytokine activity; growth factor activity; interleukin-5 receptor binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.