"IL7" Related Products

Expand
Expand

Recombinant Human IL7, StrepII-tagged

Cat.No.: IL7-271H
Product Overview: Purified, full-length human recombinant IL7 protein (amino acids 36-177, 142 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 20.2 kDa. (Accession NP_000871; UniProt P13232)
Description: IL7 is a cytokine important for B and T cell development. IL7 and the hepatocyte growth factor (HGF) form a heterodimer that functions as a pre-pro-B cell growth-stimulating factor. Il7 is found to be a cofactor for V(D)J rearrangement of the T cell receptor beta (TCRB) during early T cell development. It can be produced locally by intestinal epithelial and epithelial goblet cells, and may serve as a regulatory factor for intestinal mucosal lymphocytes. IL7 belongs to the IL-7/IL-9 family.
Source: Human Cells
Species: Human
Tag: StrepII
Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
Protein length: 36-177, 142 a.a.
AA Sequence: DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDF DLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTK EH
Endotoxin: <0.1 eu per ug protein by lal
Purity: >80% by SDS-PAGE
Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.
Gene Name: IL7 interleukin 7 [ Homo sapiens ]
Official Symbol: IL7
Synonyms: IL7; interleukin 7; interleukin-7; IL 7; IL-7;
Gene ID: 3574
mRNA Refseq: NM_000880
Protein Refseq: NP_000871
MIM: 146660
UniProt ID: P13232
Chromosome Location: 8q12-q13
Pathway: Cytokine Signaling in Immune system, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; Immune System, organism-specific biosystem; Interleukin-7 signaling, organism-specific biosystem;
Function: cytokine activity; cytokine receptor binding; growth factor activity; growth factor activity; interleukin-7 receptor binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.