"CXCL10" Related Products

Expand
Expand

Recombinant Human CXCL10, StrepII-tagged

Cat.No.: CXCL10-274H
Product Overview: Purified, full-length human recombinant CXCL10 protein (amino acids 22-98, 77 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 8.2 kDa. (Accession NP_001556; UniProt P02778)
Description: CXCL10 is a chemokine of the CXC subfamily and ligand for the receptor CXCR3. Binding of this protein to CXCR2 results in pleiotropic effects, including stimulation of monocytes, natural killer and T-cell migration, and modulation of adhesion molecule expression. In addition, CXCL10 is a chemotactic factor that attracts monocytes and T-lymphocytes. CXCL10 is induced by IFNG.
Source: Human Cells
Species: Human
Tag: StrepII
Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free)
Protein length: 22-98, 77 a.a.
AA Sequence: MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCL NPESKAIKNLLKAVSKERSKRSP
Endotoxin: <0.1 eu per μg protein by lal
Purity: >85% by SDS-PAGE
Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles
Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml
Gene Name: CXCL10 chemokine (C-X-C motif) ligand 10 [ Homo sapiens ]
Official Symbol: CXCL10
Synonyms: CXCL10; chemokine (C-X-C motif) ligand 10; INP10, SCYB10, small inducible cytokine subfamily B (Cys X Cys), member 10; C-X-C motif chemokine 10; C7; crg 2; gIP 10; IFI10; IP 10; mob 1; gamma IP10; gamma-IP10; small-inducible cytokine B10; interferon-inducible cytokine IP-10; 10 kDa interferon gamma-induced protein; protein 10 from interferon (gamma)-induced cell line; small inducible cytokine subfamily B (Cys-X-Cys), member 10; INP10; IP-10; crg-2; mob-1; SCYB10; gIP-10;
Gene ID: 3627
mRNA Refseq: NM_001565
Protein Refseq: NP_001556
MIM: 147310
UniProt ID: P02778
Chromosome Location: 4q21
Pathway: CXCR3-mediated signaling events, organism-specific biosystem; Chemokine receptors bind chemokines, organism-specific biosystem; Chemokine signaling pathway, organism-specific biosystem; Chemokine signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem;
Function: cAMP-dependent protein kinase regulator activity; chemokine activity; receptor binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.