"CDH1" Related Products

Expand
Expand
Expand

Recombinant Human CDH1, StrepII-tagged

Cat.No.: CDH1-278H
Product Overview: Purified human recombinant CDH1 (CADH1) protein (amino acids 731-882, 152 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 17.1 kDa. (Accession NP_004351.1; UniProt P12830)
Description: This product is the intracellular domain of CDH1. Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types. CDH1 is involved in mechanisms regulating cell-cell adhesions, mobility and proliferation of epithelial cells. Has a potent invasive suppressor role. It is a ligand for integrin alpha-E/beta-7. CDH1 is a homodimer comprised of five extracellular cadherin repeats, a transmembrane region, and a highly conserved cytoplasmic tail. Mutations in this gene are correlated with gastric, breast, colorectal, thyroid, and ovarian cancer.
Source: Human Cells
Species: Human
Tag: StrepII
Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free)
Protein length: 731-882, 152 a.a.
AA Sequence: LRRRAVVKEPLLPPEDDTRDNVYYYDEEGGGEEDQDFDLSQLHRGLDARPEVTRNDVAPTLMSVPRYLPRPANPD EIGNFIDENLKAADTDPTAPPYDSLLVFDYEGSGSEAASLSSLNSSESDKDQDYDYLNEWGNRFKKLADMYGGGE DD
Endotoxin: <0.1 eu per μg protein by lal
Purity: >90% by SDS-PAGE
Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles
Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml. This solution can then be diluted into other aqueous buffers and stored at 4°C for up to 1 month
Gene Name: CDH1 cadherin 1, type 1, E-cadherin (epithelial) [ Homo sapiens ]
Official Symbol: CDH1
Synonyms: CDH1; cadherin 1, type 1, E-cadherin (epithelial); UVO; cadherin-1; CD324; E Cadherin; uvomorulin; CAM 120/80; E-Cadherin; cell-CAM 120/80; epithelial cadherin; cadherin 1, E-cadherin (epithelial); calcium-dependent adhesion protein, epithelial; CDHE; ECAD; LCAM; Arc-1;
Gene ID: 999
mRNA Refseq: NM_004360
Protein Refseq: NP_004351
MIM: 192090
UniProt ID: P12830
Chromosome Location: 16q22.1
Pathway: Adaptive Immune System, organism-specific biosystem; Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; Adherens junctions interactions, organism-specific biosystem; Apoptosis, organism-specific biosystem; Apoptotic cleavage of cell adhesionproteins, organism-specific biosystem; Apoptotic cleavage of cellular proteins, organism-specific biosystem;
Function: GTPase activating protein binding; calcium ion binding; cell adhesion molecule binding; gamma-catenin binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.