"CXCL2" Related Products

Expand
Expand

Recombinant Human CXCL2, StrepII-tagged

Cat.No.: CXCL2-282H
Product Overview: Purified, full-length human recombinant GRO-beta (CXCL2) protein (amino acids 35-107, 73 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 7.9 kDa. (Accession NP_002080.1; UniProt P19875)
Description: GRO-beta belongs to the intercine alpha (CXC chemokine) family. It is produced by activated monocytes and neutrophils and expressed at sites of inflammation. GRO-beta is available as an immunomodulator and is used prior to hematopoetic transplantation for peripheral blood stem cell mobilization and reduction of incidence, duration, and/or severity of chemotherapy-induced cytopenias.
Source: Human Cells
Species: Human
Tag: StrepII
Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free)
Protein length: 35-107, 73 a.a.
AA Sequence: APLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN
Endotoxin: <0.1 eu per μg protein by lal
Purity: >90% by SDS-PAGE
Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles
Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml
Gene Name: CXCL2 chemokine (C-X-C motif) ligand 2 [ Homo sapiens ]
Official Symbol: CXCL2
Synonyms: CXCL2; chemokine (C-X-C motif) ligand 2; GRO2, GRO2 oncogene; C-X-C motif chemokine 2; CINC 2a; GROb; MGSA b; MIP 2a; SCYB2; gro-beta; MGSA beta; MIP2-alpha; GRO2 oncogene; growth-regulated protein beta; macrophage inflammatory protein 2-alpha; melanoma growth stimulatory activity beta; GRO2; MIP2; MIP2A; MGSA-b; MIP-2a; CINC-2a;
Gene ID: 2920
mRNA Refseq: NM_002089
Protein Refseq: NP_002080
MIM: 139110
UniProt ID: P19875
Chromosome Location: 4q13.3
Pathway: Chemokine receptors bind chemokines, organism-specific biosystem; Chemokine signaling pathway, organism-specific biosystem; Chemokine signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Cytokines and Inflammatory Response, organism-specific biosystem;
Function: chemokine activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.