"IL13" Related Products

Expand
Expand

Recombinant Human IL13, StrepII-tagged

Cat.No.: IL13-287H
Product Overview: Purified, full-length human recombinant IL13 protein (amino acids 25-146, 122 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 13.3 kDa. (Accession NP_002179.2; UniProt P35225)
Description: IL13 is an immunoregulatory cytokine produced primarily by activated Th2 cells. This cytokine is involved in several stages of B-cell maturation and differentiation. It up-regulates CD23 and MHC class II expression, and promotes IgE isotype switching of B cells. IL13 down-regulates macrophage activity, thereby inhibits the production of pro-inflammatory cytokines and chemokines. This cytokine is found to be critical to the pathogenesis of allergen-induced asthma but operates through mechanisms independent of IgE and eosinophils.
Source: Human Cells
Species: Human
Tag: StrepII
Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free)
Protein length: 25-146, 122 a.a.
AA Sequence: LTCLGGFASPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRM LSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN
Endotoxin: <0.1 eu per μg protein by lal
Purity: ~85% by SDS-PAGE
Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml. This solution can then be diluted into other aqueous buffers and stored at 4°C for up to 1 month.
Gene Name: IL13 interleukin 13 [ Homo sapiens ]
Official Symbol: IL13
Synonyms: IL13; interleukin 13; interleukin-13; allergic rhinitis; ALRH; BHR1; Bronchial hyperresponsiveness 1 (bronchial asthma); IL 13; MGC116786; MGC116788; MGC116789; P600; Bronchial hyperresponsiveness-1 (bronchial asthma); IL-13;
Gene ID: 3596
mRNA Refseq: NM_002188
Protein Refseq: NP_002179
MIM: 147683
UniProt ID: P35225
Chromosome Location: 5q31
Pathway: Asthma, organism-specific biosystem; Asthma, conserved biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Cytokines and Inflammatory Response, organism-specific biosystem; Fc epsilon RI signaling pathway, organism-specific biosystem; Fc epsilon RI signaling pathway, conserved biosystem;
Function: cytokine activity; interleukin-13 receptor binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.