"IL17A" Related Products

Expand
Expand
Expand

Recombinant Human IL17A, StrepII-tagged

Cat.No.: IL17A-288H
Product Overview: Purified, full-length human recombinant IL17A protein (amino acids 24-155, 132 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 30.2 kDa. (Accession NP_002181.1; UniProt Q16552)
Description: IL17A is a proinflammatory cytokine produced by activated T cells. This cytokine regulates the activities of NF-kappaB and mitogen-activated protein kinases. This cytokine can stimulate the expression of IL6 and cyclooxygenase-2 (PTGS2/COX-2), as well as enhance the production of nitric oxide (NO). High levels of this cytokine are associated with several chronic inflammatory diseases including rheumatoid arthritis, psoriasis and multiple sclerosis.
Source: Human Cells
Species: Human
Tag: StrepII
Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free)
Protein length: 24-155, 132 a.a.
AA Sequence: GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLG CINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Endotoxin: <0.1 eu per μg protein by lal
Purity: ~50% by SDS-PAGE
Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml
Gene Name: IL17A interleukin 17A [ Homo sapiens ]
Official Symbol: IL17A
Synonyms: IL17A; interleukin 17A; CTLA8, IL17, interleukin 17 (cytotoxic T lymphocyte associated serine esterase 8); interleukin-17A; cytotoxic T lymphocyte associated protein 8; IL 17; IL 17A; CTLA-8; cytotoxic T-lymphocyte-associated antigen 8; cytotoxic T-lymphocyte-associated protein 8; cytotoxic T-lymphocyte-associated serine esterase 8; interleukin 17 (cytotoxic T-lymphocyte-associated serine esterase 8); IL17; CTLA8; IL-17; IL-17A;
Gene ID: 3605
mRNA Refseq: NM_002190
Protein Refseq: NP_002181
MIM: 603149
UniProt ID: Q16552
Chromosome Location: 6p12
Pathway: Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; IL23-mediated signaling events, organism-specific biosystem; IL27-mediated signaling events, organism-specific biosystem; Rheumatoid arthritis, organism-specific biosystem; Rheumatoid arthritis, conserved biosystem;
Function: cytokine activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.