"IFNL2" Related Products

Expand
Expand

Recombinant Human IFNL2, StrepII-tagged

Cat.No.: IFNL2-298H
Product Overview: Purified, full-length human recombinant IFNL2 (IL28A) protein (amino acids 26-200, 175 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 19.8 kDa. (Accession NP_742150.1; UniProt Q8IZJ0)
Description: This is a cytokine distantly related to type I interferons and the IL-10 family. This protein, interleukin 29 (IL29), and interleukin 28B (IL28B) are three closely related cytokine genes that form a cytokine gene cluster on a chromosomal region mapped to 19q13. Expression of the cytokines encoded by the three genes can be induced by viral infection. All three cytokines have been shown to interact with a heterodimeric class II cytokine receptor that consists of interleukin 10 receptor, beta (IL10RB) and interleukin 28 receptor, alpha (IL28RA).
Source: Human Cells
Species: Human
Tag: StrepII
Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free)
Protein length: 26-200, 175 a.a.
AA Sequence: VPVARLHGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCRCHSRLFPRTWDLRQLQVRERPMALEA ELALTLKVLEATADTDPALVDVLDQPLHTLHHILSQFRACIQPQPTAGPRTRGRLHHWLYRLQEAPKKESPGCLE ASVTFNLFRLLTRDLNCVASGDLCV
Endotoxin: <0.1 eu per μg protein by lal
Purity: ~85% by SDS-PAGE
Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml
Gene Name: IL28A interleukin 28A (interferon, lambda 2) [ Homo sapiens ]
Official Symbol: IFNL2
Synonyms: IL28A; interleukin 28A (interferon, lambda 2); interleukin 28A; interleukin-28A; IFNL2; IL 28A; IFN-lambda-2; cytokine Zcyto20; interferon lambda 2; interferon lambda-2; interferon-lambda 2; IL-28A;
Gene ID: 282616
mRNA Refseq: NM_172138
Protein Refseq: NP_742150
MIM: 607401
UniProt ID: Q8IZJ0
Chromosome Location: 19q13.13
Pathway: Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem;
Function: cytokine activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.