Recombinant Human IFNL1, StrepII-tagged IFNL1-299H

Recombinant Human IFNL1, StrepII-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human IFNL1, StrepII-tagged

Recombinant Human IFNL1, StrepII-tagged

IFNL1 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : IFNL1-299H
Product Overview : Purified, full-length human recombinant IFNL1 (IL29) protein (amino acids 20-200, 181 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 20.0 kDa. (Accession NP_742152.1; UniProt Q8IU54)
Description : This is a cytokine distantly related to type I interferons and the IL-10 family. This protein, interleukin 28A (IL28A), and interleukin 28B (IL28B) are three closely related cytokine genes that form a cytokine gene cluster on a chromosomal region mapped to 19q13. Expression of the cytokines encoded by the three genes can be induced by viral infection. All three cytokines have been shown to interact with a heterodimeric class II cytokine receptor that consists of interleukin 10 receptor, beta (IL10RB) and interleukin 28 receptor, alpha (IL28RA).
Source : Human Cells
Species : Human
Tag : StrepII
Form : Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free)
Protein length : 20-200, 181 a.a.
AA Sequence : GPVPTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAE LALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASV TFNLFRLLTRDLKYVADGNLCLRTSTHPEST
Endotoxin : <0.1 eu per μg protein by lal
Purity : >90% by SDS-PAGE
Storage : 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
Reconstitution : Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml. This solution can then be diluted into other aqueous buffers and stored at 4°C for up to 1 month.
Gene Name : IL29 interleukin 29 (interferon, lambda 1) [ Homo sapiens ]
Official Symbol : IFNL1
Synonyms : IL29; interleukin 29 (interferon, lambda 1); interleukin 29; interleukin-29; IFNL1; IL 29; IFN-lambda-1; cytokine Zcyto21; interferon lambda-1; interferon-lambda-1; interferon, lambda 1; IL-29;
Gene ID : 282618
mRNA Refseq : NM_172140
Protein Refseq : NP_742152
MIM : 607403
UniProt ID : Q8IU54
Chromosome Location : 19q13.13
Pathway : Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem;
Function : cytokine activity; interleukin-28 receptor binding; receptor binding;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy