"GYS1" Related Products

Expand
Expand
Expand

Recombinant Human GYS1, GST-tagged

Cat.No.: GYS1-12H
Product Overview: Recombinant Human GYS1(1 a.a. - 737 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description: The protein encoded by this gene catalyzes the addition of glucose monomers to the growing glycogen molecule through the formation of alpha-1,4-glycoside linkages. Mutations in this gene are associated with muscle glycogen storage disease. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Source: Wheat germ
Species: Human
Tag: GST
Molecular Mass: 106.59 kDa
AA Sequence: MPLNRTLSMSSLPGLEDWEDEFDLENAVLFEVAWEVANKVGGIYTVLQTKAKVTGDEWGDNYFLVGPYTEQGVRT QVELLEAPTPALKRTLDSMNSKGCKVYFGRWLIEGGPLVVLLDVGASAWALERWKGELWDTCNIGVPWYDREAND AVLFGFLTTWFLGEFLAQSEEKPHVVAHFHEWLAGVGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLE NFNVDKEAGERQIYHRYCMERAAAHCAHVFTTVSQITAIEAQHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQS KARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSEQTVVAFFIMPARTNNF NVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPDMNKMLDKEDFTMMKRAIFATQRQSFPPVCTHNMLD DSSDPILTTIRRIGLFNSSADRVKVIFHPEFLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIP SISTNLSGFGCFMEEHIADPSAYGIYILDRRFRSPDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKY LGRYYMSARHMALSKAFPEHFTYEPNEADAAQGYRYPRPASVPPSPSLSRHSSPHQSEDEEDPRNGPLEEDGERY DEDEEAAKDRRNIRAPEWPRRASCTSSTSGSKRNSVDTATSSSLSTPSEPLSPTSSLGEERN
Applications: ELISA; WB-Re; AP; Array
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: GYS1 glycogen synthase 1 (muscle) [ Homo sapiens (human) ]
Official Symbol: GYS1
Synonyms: GYS1; GSY; GYS; glycogen synthase 1 (muscle); glycogen [starch] synthase, muscle; NP_001155059.1; EC 2.4.1.11; NP_002094.2
Gene ID: 2997
mRNA Refseq: NM_002103
Protein Refseq: NP_002094
MIM: 138570
UniProt ID: P13807
Chromosome Location: 19q13.3
Pathway: Glucose metabolism; Insulin Signaling; Metabolism of carbohydrates
Function: glucose binding; glycogen (starch) synthase activity; glycogen synthase activity, transferring glucose-1-phosphate

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.