"NELL1" Related Products

Expand

Recombinant Human NELL1, His-tagged

Cat.No.: NELL1-106H
Product Overview: Recombinant Human Protein Kinase C-Binding Protein NELL1/NELL1 is produced in mammalian expression system in human cells. The target protein is expressed with sequence (Arg17-Asn810) of Human NELL1 fused with a 6His tag at the C-terminus.
Description: This gene encodes a cytoplasmic protein that contains epidermal growth factor (EGF)-like repeats. The encoded heterotrimeric protein may be involved in cell growth regulation and differentiation. A similar protein in rodents is involved in craniosynostosis. Alternative splicing results in multiple transcript variants.
Source: HEK293
Species: Human
Tag: His
Form: Supplied as a 0.2 uM filtered solution of 20mM TrisHCl,150mM NaCl,10% Glycerol,pH8.0.
AA Sequence: RTVVGFGMDPDLQMDIVTELDLVNTTLGVAQVSGMHNASKAFLFQDIEREIHAAPHVSEKLIQLF QNKSEFTILATVQQKPSTSGVILSIRELEHSYFELESSGLRDEIRYHYIHNGKPRTEALPYRMAD GQWHKVALSVSASHLLLHVDCNRIYERVIDPPDTNLPPGINLWLGQRNQKHGLFKGIIQDGKIIF MPNGYITQCPNLNHTCPTCSDFLSLVQGIMDLQELLAKMTAKLNYAETRLSQLENCHCEKTCQVS GLLYRDQDSWVDGDHCRNCTCKSGAVECRRMSCPPLNCSPDSLPVHIAGQCCKVCRPKCIYGGKV LAEGQRILTKSCRECRGGVLVKITEMCPPLNCSEKDHILPENQCCRVCRGHNFCAEGPKCGENSE CKNWNTKATCECKSGYISVQGDSAYCEDIDECAAKMHYCHANTVCVNLPGLYRCDCVPGYIRVDD FSCTEHDECGSGQHNCDENAICTNTVQGHSCTCKPGYVGNGTICRAFCEEGCRYGGTCVAPNKCV CPSGFTGSHCEKDIDECSEGIIECHNHSRCVNLPGWYHCECRSGFHDDGTYSLSGESCIDIDECA LRTHTCWNDSACINLAGGFDCLCPSGPSCSGDCPHEGGLKHNGQVWTLKEDRCSVCSCKDGKIFC RRTACDCQNPSADLFCCPECDTRVTSQCLDQNGHKLYRSGDNWTHSCQQCRCLEGEVDCWPLTCP NLSCEYTAILEGECCPRCVSDPCLADNITYDIRKTCLDSYGVSRLSGSVWTMAGSPCTTCKCKNG RVCCSVDFECLQNNLDHHHHHH
Endotoxin: Less than 0.1 ng/µg (1 IEU/µg).
Purity: Greater than 95% as determined by reducing SDS-PAGE.
Storage: Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Gene Name: NELL1 NEL-like 1 (chicken) [ Homo sapiens (human) ]
Official Symbol: NELL1
Synonyms: NELL1; NRP1; IDH3GL; NEL-like 1 (chicken); protein kinase C-binding protein NELL1; nel-related protein 1; neural epidermal growth factor-like 1
Gene ID: 4745
mRNA Refseq: NM_006157
Protein Refseq: NP_006148
MIM: 602319
UniProt ID: Q92832
Chromosome Location: 11p15.1
Function: calcium ion binding; protein binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.