"MSH6" Related Products

Expand
Expand

Recombinant Human MSH6, GST-tagged

Cat.No.: MSH6-2414H
Product Overview: Recombinant Human MSH6(931 a.a. - 1030 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description: This gene encodes a member of the DNA mismatch repair MutS family. In E. coli, the MutS protein helps in the recognition of mismatched nucleotides prior to their repair. A highly conserved region of approximately 150 aa, called the Walker-A adenine nucleotide binding motif, exists in MutS homologs. The encoded protein heterodimerizes with MSH2 to form a mismatch recognition complex that functions as a bidirectional molecular switch that exchanges ADP and ATP as DNA mismatches are bound and dissociated. Mutations in this gene may be associated with hereditary nonpolyposis colon cancer, colorectal cancer, and endometrial cancer. Transcripts variants encoding different isoforms have been described.
Source: Wheat Germ
Species: Human
Tag: GST
Molecular Mass: 36.74 kDa
AA Sequence: AGFDSDYDQALADIRENEQSLLEYLEKQRNRIGCRTIVYWGIGRNRYQLEIPENFTTRNLPEEYELKSTKKGCKR YWTKTIEKKLANLINAEERRDVSLK
Applications: ELISA; WB-Re; AP; Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: MSH6 mutS homolog 6 [ Homo sapiens (human) ]
Official Symbol: MSH6
Synonyms: MSH6; GTBP; HSAP; p160; GTMBP; HNPCC5; mutS homolog 6; DNA mismatch repair protein Msh6; sperm-associated protein; mutS-alpha 160 kDa subunit; G/T mismatch-binding protein
Gene ID: 2956
mRNA Refseq: NM_000179
Protein Refseq: NP_000170
MIM: 600678
UniProt ID: P52701
Chromosome Location: 2p16
Pathway: BRCA1-associated genome surveillance complex (BASC); Colorectal cancer; Mismatch repair
Function: contributes_to ADP binding; contributes_to ATPase activity; contributes_to MutLalpha complex binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.