"NME7" Related Products

Expand

Recombinant Human NME7, GST-tagged

Cat.No.: NME7-50H
Product Overview: Recombinant Human NME7(1 a.a. - 376 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Source: Wheat germ
Species: Human
Tag: GST
Molecular Mass: 68.9 kDa
AA Sequence: MNHSERFVFIAEWYDPNASLLRRYELLFYPGDGSVEMHDVKNHRTFLKRTKYDNLHLEDLFIGNKVNVFSRQLVL IDYGDQYTARQLGSRKEKTLALIKPDAISKAGEIIEIINKAGFTITKLKMMMLSRKEALDFHVDHQSRPFFNELI QFITTGPIIAMEILRDDAICEWKRLLGPANSGVARTDASESIRALFGTDGIRNAAHGPDSFASAAREMELFFPSS GGCGPANTAKFTNCTCCIVKPHAVSEGLLGKILMAIRDAGFEISAMQMFNMDRVNVEEFYEVYKGVVTEYHDMVT EMYSGPCVAMEIQQNNATKTFREFCGPADPEIARHLRPGTLRAIFGKTKIQNAVHCTDLPEDGLLEVQYFFKILD N
Applications: ELISA; WB-Re; AP; Array
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: NME7 non-metastatic cells 7, protein expressed in (nucleoside-diphosphate kinase) [Homo sapiens]
Official Symbol: NME7
Synonyms: NME7; NME/NM23 family member 7; non-metastatic cells 7, protein expressed in (nucleoside-diphosphate kinase); EC 2.7.4.6; FLJ37194; MN23H7; NDK 7; nucleoside diphosphate kinase 7; NDP kinase 7; nucleoside-diphosphate kinase 7; nm23-H7; OTTHUMP00000032536; OTTHUMP00000231077; OTTHUMP00000231078
Gene ID: 29922
mRNA Refseq: NM_013330
Protein Refseq: NP_037462
MIM: 613465
UniProt ID: Q9Y5B8
Chromosome Location: 1q24
Pathway: Adenine ribonucleotide biosynthesis, IMP =>ADP,ATP; Purine metabolism; Pyrimidine ribonucleotide biosynthesis, UMP =>UDP/UTP,CDP/CTP
Function: ATP binding; metal ion binding; nucleoside diphosphate kinase activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.