"NTF3" Related Products

Expand
Expand

Recombinant Human NTF3, StrepII-tagged

Cat.No.: NTF3-16H
Product Overview: Recombinant full-length Human NTF3 (Accession NP_002518.1; UniProt P20783) protein (amino acids 19-257, 239 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 27.3 kDa.
Description: NTF3 is a member of the neurotrophin family, that controls survival and differentiation of mammalian neurons. This protein is closely related to both nerve growth factor (NGF) and brain-derived neurotrophic factor (BDNF). It may be involved in the maintenance of the adult nervous system, and may affect development of neurons in the embryo when it is expressed in human placenta.
Source: Human cell line
Species: Human
Tag: StrepII
Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
Protein length: 19-257, 239 a.a.
AA Sequence: NNMDQRSLPEDSLNSLIIKLIQADILKNKLSKQMVDVKENYQSTLPKAEAPREPERGGPAKSAFQPVIAMDTELL RQQRRYNSPRVLLSDSTPLEPPPLYLMEDYVGSPVVANRTSRRKRYAEHKSHRGEYSVCDSESLWVTDKSSAIDI RGHQVTVLGEIKTGNSPVKQYFYETRCKEARPVKNGCRGIDDKHWNSQCKTSQTYVRALTSENNKLVGWRWIRID TSCVCALSRKIGRT
Endotoxin: <0.1 EU per ug protein by LAL method
Purity: >80% pure by SDS-PAGE
Storage: 12 months at -20°C as supplied; 1 month at 4¡ãC after reconstitution. Avoid freeze/thaw cycles.
Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.
Gene Name: NTF3 neurotrophin 3 [ Homo sapiens (human) ]
Official Symbol: NTF3
Synonyms: NT3; HDNF; NGF2; NT-3; NGF-2; neurotrophin-3; neurotrophic factor; nerve growth factor 2
Gene ID: 4908
mRNA Refseq: NM_002527
Protein Refseq: NP_002518
MIM: 162660
UniProt ID: P20783
Chromosome Location: 12p13
Pathway: BDNF signaling pathway, organism-specific biosystem; MAPK signaling pathway, organism-specific biosystem; Neurotrophic factor-mediated Trk receptor signaling, organism-specific biosystem
Function: chemoattractant activity; growth factor activity; nerve growth factor binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.