"FAM20A" Related Products

Expand

Recombinant Human FAM20A, GST-tagged

Cat.No.: FAM20A-162H
Product Overview: Recombinant Human FAM20A(1 a.a. - 541 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description: This locus encodes a protein that is likely secreted and may function in hematopoiesis. A mutation at this locus has been associated with amelogenesis imperfecta and gingival hyperplasia syndrome. Alternatively spliced transcript variants have been identified.
Source: Wheat germ
Species: Human
Tag: GST
Molecular Mass: 87.8 kDa
AA Sequence: MPGLRRDRLLTLLLLGALLSADLYFHLWPQVQRQLRPRERPRGCPCTGRASSLARDSAAAASDPGTIVHNFSRTE PRTEPAGGSHSGSSSKLQALFAHPLYNVPEEPPLLGAEDSLLASQEALRYYRRKVARWNRRHKMYREQMNLTSLD PPLQLRLEASWVQFHLGINRHGLYSRSSPVVSKLLQDMRHFPTISADYSQDEKALLGACDCTQIVKPSGVHLKLV LRFSDFGKAMFKPMRQQRDEETPVDFFYFIDFQRHNAEIAAFHLDRILDFRRVPPTVGRIVNVTKEILEVTKNEI LQSVFFVSPASNVCFFAKCPYMCKTEYAVCGKPHLLEGSLSAFLPSLNLAPRLSVPNPWIRSYTLAGKEEWEVNP LYCDTVKQIYPYNNSQRLLNVIDMAIFDFLIGNMDRHHYEMFTKFGDDGFLIHLDNARGFGRHSHDEISILSPLS QCCMIKKKTLLHLQLLAQADYRLSDVMRESLLEDQLSPVLTEPHLLALDRRLQTILRTVEGCIVAHGQQSVIVDG PVEQSAPDSGQANLTS
Applications: ELISA; WB-Re; AP; Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: FAM20A family with sequence similarity 20, member A [ Homo sapiens ]
Official Symbol: FAM20A
Synonyms: FAM20A; family with sequence similarity 20, member A; protein FAM20A; DKFZp434F2322; AIGFS; FP2747; AI1G
Gene ID: 54757
mRNA Refseq: NM_001243746
Protein Refseq: NP_001230675
MIM: 611062
UniProt ID: Q96MK3
Chromosome Location: 17q24.2

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.