Recombinant Human ANGPTL4, GST-tagged ANGPTL4-27H

Recombinant Human ANGPTL4, GST-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human ANGPTL4, GST-tagged

Recombinant Human ANGPTL4, GST-tagged

ANGPTL4 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : ANGPTL4-27H
Product Overview : Recombinant Human ANGPTL4(26 a.a. - 406 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description : This gene encodes a glycosylated, secreted protein containing a C-terminal fibrinogen domain. The encoded protein is induced by peroxisome proliferation activators and functions as a serum hormone that regulates glucose homeostasis, lipid metabolism, and insulin sensitivity. This protein can also act as an apoptosis survival factor for vascular endothelial cells and can prevent metastasis by inhibiting vascular growth and tumor cell invasion. The C-terminal domain may be proteolytically-cleaved from the full-length secreted protein. Decreased expression of this gene has been associated with type 2 diabetes. Alternative splicing results in multiple transcript variants. This gene was previously referred to as ANGPTL2 but has been renamed ANGPTL4.
Source : Wheat germ
Species : Human
Tag : GST
Molecular Mass : 67.65 kDa
AA Sequence : GPVQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLSALERRLSACGSACQGTEGSTDLPLAPESRVDPE VLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVDPA HNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGD PHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVP FSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFRSIPQQRQKLKKGIFWKTWRGRYHPLQATTMLIQPI AAEAAS
Applications : ELISA; WB-Re; AP; Array
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name : ANGPTL4 angiopoietin-like 4 [ Homo sapiens ]
Official Symbol : ANGPTL4
Synonyms : ANGPTL4; angiopoietin-like 4; angiopoietin-related protein 4; angiopoietin related protein 4; ARP4; fasting induced adipose factor; FIAF; hepatic angiopoietin related protein; hepatic fibrinogen/angiopoietin related protein; HFARP; NL2; peroxisome prolife
Gene ID : 51129
mRNA Refseq : NM_001039667
Protein Refseq : NP_001034756
MIM : 605910
UniProt ID : Q9BY76
Chromosome Location : 19p13.3
Pathway : Developmental Biology; PPAR signaling pathway; Regulation of lipid metabolism by Peroxisome proliferator-activated receptor alpha (PPARalpha)
Function : enzyme inhibitor activity; protein binding

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy