"MALT1" Related Products

Expand
Expand

Recombinant Human MALT1, GST-tagged

Cat.No.: MALT1-27H
Product Overview: Recombinant Human MALT1(1 a.a. - 813 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description: This gene has been found to be recurrently rearranged in chromosomal translocation with two other genes - baculoviral IAP repeat-containing protein 3 (also known as apoptosis inhibitor 2) and immunoglobulin heavy chain locus - in mucosa-associated lymphoid tissue lymphomas. The protein encoded by this gene may play a role in NF-kappaB activation. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Source: Wheat germ
Species: Human
Tag: GST
Molecular Mass: 117.5 kDa
AA Sequence: MSLLGDPLQALPPSAAPTGPLLAPPAGATLNRLREPLLRRLSELLDQAPEGRGWRRLAELAGSRGRLRLSCLDLE QCSLKVLEPEGSPSLCLLKLMGEKGCTVTELSDFLQAMEHTEVLQLLSPPGIKITVNPESKAVLAGQFVKLCCRA TGHPFVQYQWFKMNKEIPNGNTSELIFNAVHVKDAGFYVCRVNNNFTFEFSQWSQLDVCDIPESFQRSVDGVSES KLQICVEPTSQKLMPGSTLVLQCVAVGSPIPHYQWFKNELPLTHETKKLYMVPYVDLEHQGTYWCHVYNDRDSQD SKKVEIIIDELNNLGHPDNKEQTTDQPLAKDKVALLIGNMNYREHPKLKAPLVDVYELTNLLRQLDFKVVSLLDL TEYEMRNAVDEFLLLLDKGVYGLLYYAGHGYENFGNSFMVPVDAPNPYRSENCLCVQNILKLMQEKETGLNVFLL DMCRKRNDYDDTIPILDALKVTANIVFGYATCQGAEAFEIQHSGLANGIFMKFLKDRLLEDKKITVLLDEVAEDM GKCHLTKGKQALEIRSSLSEKRALTDPIQGTEYSAESLVRNLQWAKAHELPESMCLKFDCGVQIQLGFAAEFSNV MIIYTSIVYKPPEIIMCDAYVTDFPLDLDIDPKDANKGTPEETGSYLVSKDLPKHCLYTRLSSLQKLKEHLVFTV CLSYQYSGLEDTVEDKQEVNVGKPLIAKLDMHRGLGRKTCFQTCLMSNGPYQSSAATSGGAGHYHSLQDPFHGVY HSHPGNPSNVTPADSCHCSRTPDAFISSFAHHASCHFSRSNVPVETTDEIPFSFSDRLRISEK
Applications: ELISA; WB-Re; AP; Array
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: MALT1 MALT1 paracaspase [ Homo sapiens (human) ]
Official Symbol: MALT1
Synonyms: MALT1; mucosa associated lymphoid tissue lymphoma translocation gene 1; MLT; mucosa-associated lymphoid tissue lymphoma translocation protein 1; paracaspase; caspase-like protein; MALT associated translocation; MALT lymphoma-associated translocation; MALT-lymphoma associated translocation; MLT1; DKFZp434L132
Gene ID: 10892
mRNA Refseq: NM_173844
Protein Refseq: NP_776216
MIM: 604860
UniProt ID: Q9UDY8
Chromosome Location: 18q21
Pathway: Activation of NF-kappaB in B cells; B cell receptor signaling pathway; BCR signaling pathway
Function: cysteine-type endopeptidase activity; peptidase activity; protein binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.