Recombinant Human DRD2 DRD2-11H

Recombinant Human DRD2

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human DRD2

Recombinant Human DRD2

DRD2 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : DRD2-11H
Product Overview : Recombinant Human DRD2, fused without tag, was expressed in wheat germ.
Description : This gene encodes the D2 subtype of the dopamine receptor. This G-protein coupled receptor inhibits adenylyl cyclase activity. A missense mutation in this gene causes myoclonus dystonia; other mutations have been associated with schizophrenia. Alternative splicing of this gene results in two transcript variants encoding different isoforms. A third variant has been described, but it has not been determined whether this form is normal or due to aberrant splicing.
Source : Wheat germ
Species : Human
Form : Liquid
Molecular Mass : 48.73 kDa
AA Sequence : MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVSREKALQTTTNYLIVS LAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKR RVTVMISIVWVLSFTISCPLLFGLNNADQNECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNT KRSSRAFRAHLRAPLKGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPP SHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSRRKLSQQKEKKATQML AIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFLKILHC
Applications : Antibody Production; Functional Study; Compound Screening
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene Name : DRD2 dopamine receptor D2 [ Homo sapiens (human) ]
Official Symbol : DRD2
Synonyms : DRD2; dopamine receptor D2; D2R; D2DR; D(2) dopamine receptor; dopamine D2 receptor; dopamine receptor D2 isoform; seven transmembrane helix receptor
Gene ID : 1813
mRNA Refseq : NM_000795
Protein Refseq : NP_000786
MIM : 126450
UniProt ID : P14416
Chromosome Location : 11q23
Pathway : Amine ligand-binding receptor; Defective ACTH causes Obesity and Pro-opiomelanocortinin deficiency (POMCD); Class A/1 (Rhodopsin-like receptors)
Function : dopamine neurotransmitter receptor activity, coupled via Gi/Go; dopamine binding; identical protein binding

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy