"DRD2" Related Products

Expand
Expand
Expand

Recombinant Human DRD2

Cat.No.: DRD2-11H
Product Overview: Recombinant Human DRD2, fused without tag, was expressed in wheat germ.
Description: This gene encodes the D2 subtype of the dopamine receptor. This G-protein coupled receptor inhibits adenylyl cyclase activity. A missense mutation in this gene causes myoclonus dystonia; other mutations have been associated with schizophrenia. Alternative splicing of this gene results in two transcript variants encoding different isoforms. A third variant has been described, but it has not been determined whether this form is normal or due to aberrant splicing.
Source: Wheat germ
Species: Human
Form: Liquid
Molecular Mass: 48.73 kDa
AA Sequence: MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVSREKALQTTTNYLIVS LAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKR RVTVMISIVWVLSFTISCPLLFGLNNADQNECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNT KRSSRAFRAHLRAPLKGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPP SHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSRRKLSQQKEKKATQML AIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFLKILHC
Applications: Antibody Production; Functional Study; Compound Screening
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene Name: DRD2 dopamine receptor D2 [ Homo sapiens (human) ]
Official Symbol: DRD2
Synonyms: DRD2; dopamine receptor D2; D2R; D2DR; D(2) dopamine receptor; dopamine D2 receptor; dopamine receptor D2 isoform; seven transmembrane helix receptor
Gene ID: 1813
mRNA Refseq: NM_000795
Protein Refseq: NP_000786
MIM: 126450
UniProt ID: P14416
Chromosome Location: 11q23
Pathway: Amine ligand-binding receptor; Defective ACTH causes Obesity and Pro-opiomelanocortinin deficiency (POMCD); Class A/1 (Rhodopsin-like receptors)
Function: dopamine neurotransmitter receptor activity, coupled via Gi/Go; dopamine binding; identical protein binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.