"RSPO1" Related Products

Expand
Expand
Expand

Recombinant Human RSPO1, Fc-tagged

Cat.No.: RSPO1-671H
Product Overview: The recombinant human RPSO1-Fc fusion is expressed as a 481 amino acid protein consisting of Ser21 - Ala263 region of (UniProt accession #Q2MKA7) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
Source: Human cells
Species: Human
Tag: Fc
Form: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free).
Bio-activity: Synergizes with Wnt3a to stabilize β-catenin protein levels and induces the activation of β-catenin responsive Luciferase reporter gene in HEK293 cells with a typical ED50 of 50 - 200 ng/ml.
Molecular Mass: Calculated molecular mass (kDa): 53.5; Estimated by SDS-PAGE under reducing condition (kDa): 55-60.
AA Sequence: SRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCI KCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFR RGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRK GQQQQQQQGTVGPLTSAGPASTTENLYFQGSTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVV VDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTIS KAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin: <0.1 eu per 1 μg of purified recombinant protein determined by the lal>
Purity: >95% judged by SDS-PAGE under reducing condition
Storage: The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name: RSPO1 R-spondin 1 [ Homo sapiens ]
Official Symbol: RSPO1
Synonyms: RSPO1; R-spondin 1; R spondin homolog (Xenopus laevis); R-spondin-1; FLJ40906; RSPONDIN; R-spondin homolog; roof plate-specific spondin-1; RSPO; CRISTIN3; RP11-566C13.1;
Gene ID: 284654
mRNA Refseq: NM_001038633
Protein Refseq: NP_001033722
MIM: 609595
UniProt ID: Q2MKA7
Chromosome Location: 1p34.2
Pathway: Wnt signaling network, organism-specific biosystem;
Function: heparin binding; protein binding; receptor binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.