Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Active Recombinant Human Interleukin 6 (Interferon, Beta 2)

Cat.No. : IL6-128H
Product Overview : Recombinant Human interleukin 6 (interferon, beta 2) protein sequence (containing the signal peptide sequence, and the mature human Interleukin 4 sequence) and was expressed in modifiedhuman 293 cells.
  • Specification
  • Gene Information
  • Related Products
Cat. No. : IL6-128H
Description : IL-6 is a pleotropic cytokine that regulates the development, proliferation and maturation of a number of hematopoietic cells and is essential for the maturation of B cells into immunoglobulin-secreting cells.
Source : Human 293 cells.
Amino Acid Sequence : APVPPGEDSKDVAA PHRQPLTSSER IDKQIRYILDG ISALRKETCN KSNMCESSK EALAENNLN LPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVY LEYLQNRFE SSE EQARAV QMST KVLIQFL QKKAKN LDAITTPDPTT NASLLTKLQA QNQWLQDMT T HLI L RSFK EFLQSSLRALRQM.
Molecular Mass : IL-6 migrates as a broad band between 20 and 25 kDa in SDS-PAGE due to post-translation modifications, in particular glycosylation. This compares with the unmodified IL-6 that has a predicted molecular mass of 21.0kDa.
PI : IL-6 separates into a number of isoforms with a pI between 5.5 and 7.2 in 2D PAGE due to post-translational modifications, in particular glycosylation. This compares with the unmodified IL-6 that has a predicted pI of 6.22.
% Carbohydrate : Purified IL-6 consists of 0-20% carbohydrate by weight.
Purity : >95%, as determined by SDS-PAGE and visualized by silver stain.
Formulation : When reconstituted in 0.5 ml sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose.
Reconstitution : It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.
Storage : Lyophilized products should be stored at 2 to 8°C. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.
Activity : The ED50of IL-6 is typically 0.15 - 0.35 ng/ml as measured in a cell proliferation assay using a human growth factor-dependent TF-1 cell line.
Gene Name : IL6 interleukin 6 (interferon, beta 2) [ Homo sapiens ]
Synonyms : IL6; interleukin 6 (interferon, beta 2); BSF2; HGF; HSF; IFNB2; IL-6; B cell stimulatory factor-2; B-cell differentiation factor; CTL differentiation factor; OTTHUMP00000158544; hybridoma growth factor; interleukin 6; interleukin BSF-2; (interferon, beta 2); Hybridoma growth factor
Gene ID : 3569
mRNA Refseq : NM_000600
Protein Refseq : NP_000591
MIM : 147620
UniProt ID : P05231
Chromosome Location : 7p21
Pathway : Cytokine-cytokine receptor interaction; Jak-STAT signaling pathway; Hematopoietic cell lineage; Graft-versus-host disease; Hypertrophic cardiomyopathy (HCM); Pathways in cancer; Prion diseases; Toll-like receptor signaling pathway
Function : interleukin-6 receptor activity; cytokine activity; growth factor activity

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (6)

Ask a question
What is the dosage and usage of Il6? 07/15/2022

The dosage and usage of Il6 will vary according to the disease, and generally require individualized regulation by the physician according to the disease situation.

What are the pharmacokinetic properties of Il6? 06/16/2022

The pharmacokinetic characteristics of Il6 mainly include drug absorption, distribution, metabolism, excretion and other information.

Does Il6 have advantages in the treatment of multiple myeloma? 04/22/2022

Recombinant Il6 protein has a unique therapeutic advantage in the treatment of multiple myeloma. It can promote the proliferation and differentiation of hematopoietic stem cells and inhibit the growth of tumor cells.

Does Il6 have specific therapeutic effects for certain diseases? 05/27/2020

Il6 has specific therapeutic effects for certain diseases, such as rheumatoid arthritis, multiple myeloma and so on.

In which diseases is Il6 widely used? 11/20/2019

This protein is widely used in the treatment of rheumatoid arthritis, pneumonia, multiple myeloma, lymphoma, malignant tumors and other diseases.

What is the effect of Il6 on immune cells? 05/21/2019

The effects of Il6 on immune cells are mainly manifested as promoting cell proliferation and differentiation, regulating immune response, etc.

Customer Reviews (3)

Write a review
Reviews
03/05/2022

    Accurate localization and function within the cell.

    01/31/2021

      The binding affinity and affinity constant with the target are high.

      03/12/2020

        Can form a stable micellar structure.

        Ask a Question for All IL6 Products

        Required fields are marked with *

        My Review for All IL6 Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /

        Stay Updated on the Latest Bioscience Trends