Recombinant Human Interleukin 6 (Interferon, Beta 2)

Cat. No.: IL6-128H
Product Overview: Recombinant Human interleukin 6 (interferon, beta 2) protein sequence (containing the signal peptide sequence, and the mature human Interleukin 4 sequence) and was expressed in modifiedhuman 293 cells.
Description: IL-6 is a pleotropic cytokine that regulates the development, proliferation and maturation of a number of hematopoietic cells and is essential for the maturation of B cells into immunoglobulin-secreting cells.
Source: Human 293 cells.
Amino Acid Sequence: APVPPGEDSKDVAA PHRQPLTSSER IDKQIRYILDG ISALRKETCN KSNMCESSK EALAENNLN LPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVY LEYLQNRFE SSE EQARAV QMST KVLIQFL QKKAKN LDAITTPDPTT NASLLTKLQA QNQWLQDMT T HLI L RSFK EFLQSSLRALRQM.
Molecular Mass: IL-6 migrates as a broad band between 20 and 25 kDa in SDS-PAGE due to post-translation modifications, in particular glycosylation. This compares with the unmodified IL-6 that has a predicted molecular mass of 21.0kDa.
PI: IL-6 separates into a number of isoforms with a pI between 5.5 and 7.2 in 2D PAGE due to post-translational modifications, in particular glycosylation. This compares with the unmodified IL-6 that has a predicted pI of 6.22.
% Carbohydrate: Purified IL-6 consists of 0-20% carbohydrate by weight.
Purity: >95%, as determined by SDS-PAGE and visualized by silver stain.
Formulation: When reconstituted in 0.5 ml sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose.
Reconstitution: It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.
Storage: Lyophilized products should be stored at 2 to 8°C. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.
Activity: The ED50of IL-6 is typically 0.15 - 0.35 ng/ml as measured in a cell proliferation assay using a human growth factor-dependent TF-1 cell line.
Gene Name: IL6 interleukin 6 (interferon, beta 2) [ Homo sapiens ]
Synonyms: IL6; interleukin 6 (interferon, beta 2); BSF2; HGF; HSF; IFNB2; IL-6; B cell stimulatory factor-2; B-cell differentiation factor; CTL differentiation factor; OTTHUMP00000158544; hybridoma growth factor; interleukin 6; interleukin BSF-2; (interferon, beta 2); Hybridoma growth factor
Gene ID: 3569
mRNA Refseq: NM_000600
Protein Refseq: NP_000591
MIM: 147620
UniProt ID: P05231
Chromosome Location: 7p21
Pathway: Cytokine-cytokine receptor interaction; Jak-STAT signaling pathway; Hematopoietic cell lineage; Graft-versus-host disease; Hypertrophic cardiomyopathy (HCM); Pathways in cancer; Prion diseases; Toll-like receptor signaling pathway
Function: interleukin-6 receptor activity; cytokine activity; growth factor activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.