"TGFBR2" Related Products

Expand
Expand
Expand

Recombinant Human TGFBR2, Fc Chimera

Cat. No.: TGFBR2-151H
Product Overview: Recombinant Human transforming growth factor, beta receptor II was fused to the Fc region of human IgG1 (aa 93-330). The chimeric protein was expressed in modifiedhuman 293 cells.
Description: Transforming growth factor-beta (TGF-beta; TGF-b) is a pleiotropic cytokine that controls the growth, survival, motility and differentiation of cells. It is involved in the degradation and remodelling of the extracellular matrix (ECM), and has an important role in development during embryogenesis. The biological effects of TGF-beta are mediated by binding to TGF-beta receptors; TGF-beta RI, TGF-beta RII (TGF-beta R2 ) , and TGF-beta RIII ( TGF-beta R3 ). TGF-beta RII is synthesized as a 567 amino acid protein including a 22 amino acid signal sequence, a 144 amino acid extracellular domain, a 21 amino acid transmembrane domain and a 380 amino acid cytoplasmic domain containing a Ser/Thr protein kinase. TGF-beta RII contains 3 N-linked glycosylation sites.
Source: human 293 cells.
Theoretical Sequence: TIPPHVQKSVNND MIVTDNNGAVKFPQL CKFCDVRFSTCDNQ KSCMS NCSITS ICEK P QEVCVAVWRKNDENI TLETVCHDPKLPY HDFILEDAASPKCIMK EKKK P GET FFMCS CSS DECNDNIIFSEEYNTSNP DRIPKVDKKVEPKSCD KT HT C PP CP APELLGG PSVFLFPP KPKDTLM ISRTPEVTCVVVDVS H ED PE VK FN WY VD G VEVHNAKTKPREEQY NSTYRVVSVLTVLH QDWLNGKEYKCRVS NK AL PA PIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNG Q PENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKS LSLSPGK.
Molecular Mass: TGF-beta RII-Fc Chimera migrates as a broad band between 45 and 70 kDa in SDS-PAGE due to post-translation modifications, in particular glycosylation. This compares with the unmodified TGF-beta RII-Fc Chimera that has a predicted molecular mass of 42.7kDa.
PI: TGF-beta RII-Fc Chimera separates into a number of isoforms with a pI between 4.7 and 7.2 in 2D PAGE due to post-translational modifications, in particular glycosylation, the. This compares with the unmodified TGF-beta RII-Fc Chimera that has a predicted pI of 6.22.
% Carbohydrate: TGF-beta RII-Fc Chimera consists of 5-40% carbohydrate by weight.
Purity: >95%, as determined by SDS-PAGE and visualized by silver stain.
Formulation: When reconstituted in 0.5 ml sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose.
Reconstitution: It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.
Storage: Lyophilized products should be stored at 2 to 8°C. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C.
Gene Name: TGFBR2 transforming growth factor, beta receptor II (70/80kDa) [ Homo sapiens ]
Synonyms: transforming growth factor, beta receptor II (70/80kDa); AAT3; FAA3; MFS2; RIIC; LDS1B; LDS2B; TAAD2; TGFR-2; TGFbeta-RII; TGFBR2; transforming growth factor, beta receptor II; TGF-beta type II receptor; TGF-beta receptor type IIB; transforming growth factor beta receptor type IIC
Gene ID: 7048
mRNA Refseq: NM_001024847
Protein Refseq: NP_001020018
MIM: 190182
UniProt ID: P37173
Chromosome Location: 3p22
Pathway: Adherens junction; Chronic myeloid leukemia; Colorectal cancer; Cytokine-cytokine receptor interaction; Endocytosis; MAPK signaling pathway; Pancreatic cancer; Pathways in cancer; TGF-beta signaling pathway; Signaling by TGF beta
Function: ATP binding; SMAD binding; glycosaminoglycan binding; magnesium ion binding; manganese ion binding; nucleotide binding; protein heterodimerization activity; receptor activity; transferase activity; transforming growth factor beta binding; transforming growth factor beta receptor activity, type II; type I transforming growth factor beta receptor binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.