"TNFRSF1B" Related Products

Expand
Expand
Expand

Recombinant Human TNFRSF1B, Fc Chimera

Cat. No.: TNFRSF1B-153H
Product Overview: Recombinant Human tumor necrosis factor receptor 2 was fused to the Fc region of human IgG1 (aa 93-330). The chimeric protein was expressed in modifiedhuman 293 cells.
Description: Tumor necrosis factor alpha (TNF-alpha ; TNF alpha) and the structurally related lymphotoxin-alpha (LT-a) are pro-inflammatory cytokines produced by a variety of immune and non-immune cells in response to multiple stimuli. These stimuli can include bacteria and bacterial products such as LPS, viral infections, T-cell receptor activation and cross-linking of surface immunoglobulin (Ig) on B cells. Expression of TNF-a has been detected in macrophages/monocytes, B-cells, T-cells, basophils, eosinophils, glial cells and mast cells. The effects of TNF-alpha and LT-a are mediated through the TNF receptors, TNF RI and TNF RII.
Source: human 293 cells.
Theoretical Sequence: LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCD SCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALS KQEGCRLCAPLRKCR PGFGVARPG TETSDVVCKP CAPGTFSNTSSTD IC RPHQ ICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPT PEPSTA PS TSFLLPMGPSPPAEGIPKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKP K DTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNST YRV VSVLTVLHQDW LNGKEYK CRVSNKA LPAPIEKTISKAKGQ PREPQVY TLPPSRD ELTKNQVSLTCLVKGFYPSDIAVEWESNGQ PENNYKTTP PVLDSDG SFFLYSKL TVD KSRWQQGN VFSC SV MH EAL HN HYT QK S LS LSPGK.
Molecular Mass: TNF RII-Fc Chimera migrates as a band between 55 and 80 kDa in SDS-PAGE due to post-translation modifications, in particular glycosylation. This compares with the unmodified TNF RII-Fc Chimera that has a predicted molecular mass of 51.8 kDa.
PI: TNF RII-Fc Chimera separates into a number of isoforms with a pI between 4.5 and 7.0 in 2D PAGE due to post-translational modifications, in particular glycosylation. This compares with the unmodified TNF RII-Fc Chimera that has a predicted pI of 7.9.
% Carbohydrate: TNF RII-Fc Chimera consists of 5-35% carbohydrate by weight.
Purity: >95%, as determined by SDS-PAGE and visualized by silver stain.
Formulation: When reconstituted in 0.5 ml sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose.
Reconstitution: It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.
Storage: Lyophilized products should be stored at 2 to 8°C. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C.
Activity: The ND50of TNF RII-Fc Chimera is typically 20-50 ng/ml as measured by its ability to neutralize TNF-a mediated cytoxicity in murine WEHI 164 cells in the presence of actinomycin D.
Gene Name: TNFRSF1B tumor necrosis factor receptor superfamily, member 1B [ Homo sapiens ]
Synonyms: tumor necrosis factor receptor superfamily, member 1B; p75; TBPII; TNFBR; TNFR2; CD120b; TNFR1B; TNFR80; TNF-R75; p75TNFR; TNF-R-II; TNFRSF1B; tumor necrosis factor receptor 2; p75 TNF receptorL; soluble TNFR1B variant 1; tumor necrosis factor beta receptor; tumor necrosis factor binding protein 2;
Gene ID: 7133
mRNA Refseq: NM_001066
Protein Refseq: NP_001057
MIM: 191191
UniProt ID: P20333
Chromosome Location: 1p36.22
Pathway: Adipocytokine signaling pathway; Amyotrophic lateral sclerosis (ALS); Cytokine-cytokine receptor interaction
Function: protein binding; receptor activity; tumor necrosis factor receptor activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.