"CCL28" Related Products

Expand
Expand
Expand

Recombinant Human CCL28 protein

Cat.No. : CCL28-69H
Product Overview : Recombinant Human CCL28 protein was expressed in Escherichia coli.
Description : CCL28 belongs to CC family chemokine, also named mucosae-associated epithelial chemokine (MEC). The CCL28 cDNA is located on Chr.5 in humans, and the mRNA of CCL28 is highly expressed by epithelial cells of diverse tissues including normal and pathological colon, salivary gland, mammary gland, trachea and rectum. The amino acids sequence of human and mouse CCL28 shares 83 % identity, when the protein is processed to be the mature form. CCL28 is signaling through CCR3 and CCR10, and chemotactic for resting CD4, CD8 T-cells and eosinophils.
Source : E.coli
Species : Human
Form : Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 7.4, 130 mM NaCl.
Bio-activity : Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human lymphocytes is in a concentration range of 1.0-10.0 ng/ml.
Molecular Mass : Approximately 12.4 kDa, a single non-glycosylated polypeptide chain containing 108 amino acids.
Protein length : 108
AA Sequence : SEAILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVSPHNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHETYGHKTPY
Endotoxin : Less than 1 EU/μg of rHuMEC/CCL28 as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name : CCL28
Official Symbol : CCL28
Synonyms : CCL28; chemokine (C-C motif) ligand 28; C-C motif chemokine 28; CC chemokine CCL28; CCK1; MEC; mucosae associated epithelial chemokine; SCYA28; small inducible cytokine A28; small inducible cytokine subfamily A (Cys Cys); member 28; small-inducible cytokine A28; mucosae-associated epithelial chemokine; chemokine (C-C motif) ligand 28 splice variant chi; small inducible cytokine subfamily A (Cys-Cys), member 28; MGC71902;
Gene ID : 56477
mRNA Refseq : NM_148672
Protein Refseq : NP_683513
MIM : 605240
UniProt ID : Q9NRJ3

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.