"ABCB7" Related Products

Expand

Recombinant Human ABCB7

Cat.No.: ABCB7-26039TH
Product Overview: Recombinant full length Human ABCB7 with N terminal proprietary tag; Predicted MWt 104.76 kDa.
Description: The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters.ABC proteins transport various molecules across extra- and intra-cellular membranes.ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White).This protein is a member of the MDR/TAP subfamily.Members of the MDR/TAP subfamily are involved in multidrug resistance as well as antigen presentation.This gene encodes a half-transporter involved in the transport of heme from the mitochondria to the cytosol.With iron/sulfur cluster precursors as its substrates, this protein may play a role in metal homeostasis.Mutations in this gene have been implicated in X-linked sideroblastic anemia with ataxia.
Protein length: 715 amino acids
Molecular Weight: 104.760kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: PQWRPHQLGALGTARAYQQIPESLKSITWQRLGKGNSGQF LDAAKALQVWPLIEKRTCWHGHAGGGLHTDPKEGLKDVDT RKIIKAMLSYVWPKDRPDLRARVAISLGFLGGAKAMNIVV PFMFKYAVDSLNQMSGNMLNLSDAPNTVATMATAVLIGYG VSRAGAAFFNEVRNAVFGKVAQNSIRRIAKNVFLHLHNLD LGFHLSRQTGALSKAIDRGTRGISFVLSALVFNLLPIMFE VMLVSGVLYYKCGAQFALVTLGTLGTYTAFTVAVTRWRTR FRIEMNKADNDAGNAAIDSLLNYETVKYFNNERYEAQRYD GFLKTYETASLKSTSTLAMLNFGQSAIFSVGLTAIMVLAS QGIVAGTLTVGDLVMVNGLLFQLSLPLNFLGTVYRETRQA LIDMNTLFTLLKVDTQIKDKVMASPLQITPQTATVAFDNV HFEYIEGQKVLSGISFEVPAGKKVAIVGGSGSGKSTIVRL LFRFYEPQKGSIYLAGQNIQDVSLESLRRAVGVVPQDAVL FHNTIYYNLLYGNISASPEEVYAVAKLAGLHDAILRMPHG YDTQVGERGLKLSGGEKQRVAIARAILKDPPVILYDEATS SLDSITEETILGAMKDVVKHRTSIFIAHRLSTVVDADEII VLDQGKVAERGTHHGLLANPHSIYSEMWHTQSSRVQNHDN PKWEAKKENISKEEERKKLQEEIVNSVKGCGNCSC
Sequence Similarities: Belongs to the ABC transporter superfamily. ABCB family. Heavy Metal importer (TC 3.A.1.210) subfamily.Contains 1 ABC transmembrane type-1 domain.Contains 1 ABC transporter domain.
Gene Name: ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 [ Homo sapiens ]
Official Symbol: ABCB7
Synonyms: ABCB7; ATP-binding cassette, sub-family B (MDR/TAP), member 7; ABC7; ATP-binding cassette sub-family B member 7, mitochondrial; ASAT; Atm1p; EST140535;
Gene ID: 22
mRNA Refseq: NM_004299
Protein Refseq: NP_004290
MIM: 300135
Uniprot ID: O75027
Chromosome Location: Xq13.3
Pathway: ABC transporters, organism-specific biosystem; ABC transporters, conserved biosystem; ABC-family proteins mediated transport, organism-specific biosystem; Mitochondrial ABC transporters, organism-specific biosystem; Transmembrane transport of small molecules, organism-specific biosystem;
Function: ATP binding; ATPase activity; ATPase activity, coupled to transmembrane movement of substances; heme transporter activity; nucleotide binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.