Recombinant Human ABCC6

PRODUCTS

Home / Products / Antibody / Recombinant Human ABCC6

Recombinant Human ABCC6

ABCC6 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : ABCC6-29035TH
Product Overview : Recombinant fragment of Human MRP6 with an N terminal proprietary tag. Predicted MW 36.63 kDa.
Description : The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). The encoded protein, a member of the MRP subfamily, is involved in multi-drug resistance. Mutations in this gene cause pseudoxanthoma elasticum. Alternatively spliced transcript variants that encode different proteins have been described for this gene.
Protein length : 100 amino acids
Molecular Weight : 36.630kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Expressed in kidney and liver. Very low expression in other tissues.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : IAEMGSYQELLQRKGALVCLLDQARQPGDRGEGETEPGTSTKDPRGTSAGRRPELRRERSIKSVPEKDRTTSEAQTEVPLDDPDRAGWPAGKDSIQYGRV
Sequence Similarities : Belongs to the ABC transporter superfamily. ABCC family. Conjugate transporter (TC 3.A.1.208) subfamily.Contains 2 ABC transmembrane type-1 domains.Contains 2 ABC transporter domains.
Gene Name : ABCC6 ATP-binding cassette, sub-family C (CFTR/MRP), member 6 [ Homo sapiens ]
Official Symbol : ABCC6
Synonyms : ABCC6; ATP-binding cassette, sub-family C (CFTR/MRP), member 6; ARA, pseudoxanthoma elasticum , PXE; URG7 protein; multidrug resistance-associated protein 6; EST349056; MLP1; MRP6; URG7;
Gene ID : 368
mRNA Refseq : NM_001079528
Protein Refseq : NP_001072996
MIM : 603234
Uniprot ID : O95255
Chromosome Location : 16p13.11
Pathway : ABC transporters, organism-specific biosystem; ABC transporters, conserved biosystem; ABC-family proteins mediated transport, organism-specific biosystem; Transmembrane transport of small molecules, organism-specific biosystem;
Function : ATP binding; ATPase activity; ATPase activity, coupled to transmembrane movement of substances; nucleotide binding; transporter activity;

Online Inquiry


  •  
  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved.