"Il33" Related Products

Expand
Expand
Expand

Recombinant Mouse Il33 protein

Cat.No. : Il33-207M
Product Overview : Recombinant Mouse Il33 protein was expressed in Escherichia coli.
Description : IL-33 is a number of IL-1 superfamily, secreted by high endothelial venules at high levels, which is found in tonsils, peyer patches and mesenteric lymph nodes, but not in placenta. It elicits its biological effects by interacting with IL1RL1/ST2 and its stimulation recruits MYD88, IRAK1, IRAK4, and TRAF6, followed by phosphorylation of MAPK3/ERK1 and/or MAPK1/ERK2, MAPK14, and MAPK8. IL-33 induces production of TH2 cell related cytokines, including IL-4, IL-5 and IL-13, and exerts multiple inflammation related bioactivities. Mature IL-33 share approximately 55 % and 90 % a.a. sequence identity with human and rat IL-33 respectively.
Source : E.coli
Species : Mouse
Form : Lyophilized from a 0.2μm filtered solution in PBS, and 1 mM EDTA.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine D10S cells is less than 0.5 ng/ml, corresponding to a specific activity of > 2.0 × 106 IU/mg.
Molecular Mass : Approximately 17.5 kDa protein containing 158 amino acid residues.
Protein length : 158
AA Sequence : SIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI
Endotoxin : Less than 1 EU/µg of rMuIL-33 as determined by LAL method.
Purity : >98% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name : Il33
Official Symbol : Il33
Synonyms : IL-1F11, NF-HEV
Gene ID : 77125
mRNA Refseq : NM_001164724
Protein Refseq : NP_001158196
UniProt ID : Q8BVZ5

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.