"APEX1" Related Products

Expand
Expand
Expand

Recombinant Human APEX1, T7 -tagged

Cat.No. : APEX1-27360TH
Product Overview : Recombinant full length Human APE1 with an N terminal T7 tag; 332 amino acids with tag, Predicted MWt 36.9 kDa.
Description : Apurinic/apyrimidinic (AP) sites occur frequently in DNA molecules by spontaneous hydrolysis, by DNA damaging agents or by DNA glycosylases that remove specific abnormal bases. AP sites are pre-mutagenic lesions that can prevent normal DNA replication so the cell contains systems to identify and repair such sites. Class II AP endonucleases cleave the phosphodiester backbone 5 to the AP site. This gene encodes the major AP endonuclease in human cells. Splice variants have been found for this gene; all encode the same protein.
Protein length : 318 amino acids
Conjugation : T7
Molecular Weight : 36.900kDa inclusive of tags
Source : E. coli
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Glycerol, 0.2M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MASMTGGQQMGRGSMPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPDQKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGEEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL
Sequence Similarities : Belongs to the DNA repair enzymes AP/ExoA family.
Gene Name : APEX1 APEX nuclease (multifunctional DNA repair enzyme) 1 [ Homo sapiens ]
Official Symbol : APEX1
Synonyms : APEX1; APEX nuclease (multifunctional DNA repair enzyme) 1; APEX, APEX nuclease (multifunctional DNA repair enzyme); DNA-(apurinic or apyrimidinic site) lyase; APE; APE 1; APEN; APX; HAP1; REF 1; REF1;
Gene ID : 328
mRNA Refseq : NM_001244249
Protein Refseq : NP_001231178
MIM : 107748
Uniprot ID : P27695
Chromosome Location : 14q11.2
Pathway : BER complex, organism-specific biosystem; BER complex, conserved biosystem; Base Excision Repair, organism-specific biosystem; Base excision repair, organism-specific biosystem; Base excision repair, conserved biosystem;
Function : 3-5 exonuclease activity; 3-5 exonuclease activity; DNA binding; DNA-(apurinic or apyrimidinic site) lyase activity; DNA-(apurinic or apyrimidinic site) lyase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.