"APEX1" Related Products

Expand
Expand
Expand

Recombinant Human APEX1, T7 -tagged

Cat.No.: APEX1-27360TH
Product Overview: Recombinant full length Human APE1 with an N terminal T7 tag; 332 amino acids with tag, Predicted MWt 36.9 kDa.
Description: Apurinic/apyrimidinic (AP) sites occur frequently in DNA molecules by spontaneous hydrolysis, by DNA damaging agents or by DNA glycosylases that remove specific abnormal bases. AP sites are pre-mutagenic lesions that can prevent normal DNA replication so the cell contains systems to identify and repair such sites. Class II AP endonucleases cleave the phosphodiester backbone 5 to the AP site. This gene encodes the major AP endonuclease in human cells. Splice variants have been found for this gene; all encode the same protein.
Protein length: 318 amino acids
Conjugation: T7
Molecular Weight: 36.900kDa inclusive of tags
Source: E. coli
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 0.2M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MASMTGGQQMGRGSMPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPDQKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGEEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL
Sequence Similarities: Belongs to the DNA repair enzymes AP/ExoA family.
Gene Name: APEX1 APEX nuclease (multifunctional DNA repair enzyme) 1 [ Homo sapiens ]
Official Symbol: APEX1
Synonyms: APEX1; APEX nuclease (multifunctional DNA repair enzyme) 1; APEX, APEX nuclease (multifunctional DNA repair enzyme); DNA-(apurinic or apyrimidinic site) lyase; APE; APE 1; APEN; APX; HAP1; REF 1; REF1;
Gene ID: 328
mRNA Refseq: NM_001244249
Protein Refseq: NP_001231178
MIM: 107748
Uniprot ID: P27695
Chromosome Location: 14q11.2
Pathway: BER complex, organism-specific biosystem; BER complex, conserved biosystem; Base Excision Repair, organism-specific biosystem; Base excision repair, organism-specific biosystem; Base excision repair, conserved biosystem;
Function: 3-5 exonuclease activity; 3-5 exonuclease activity; DNA binding; DNA-(apurinic or apyrimidinic site) lyase activity; DNA-(apurinic or apyrimidinic site) lyase activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.