Recombinant Human ARRB1
Cat.No. : | ARRB1-26622TH |
Product Overview : | Recombinant full length Human beta Arrestin 1 with N terminal proprietary tag; Predicted MWt 72.05 kDa. |
- Specification
- Gene Information
- Related Products
Description : | Members of arrestin/beta-arrestin protein family are thought to participate in agonist-mediated desensitization of G-protein-coupled receptors and cause specific dampening of cellular responses to stimuli such as hormones, neurotransmitters, or sensory signals. Arrestin beta 1 is a cytosolic protein and acts as a cofactor in the beta-adrenergic receptor kinase (BARK) mediated desensitization of beta-adrenergic receptors. Besides the central nervous system, it is expressed at high levels in peripheral blood leukocytes, and thus the BARK/beta-arrestin system is believed to play a major role in regulating receptor-mediated immune functions. Alternatively spliced transcripts encoding different isoforms of arrestin beta 1 have been described. |
Protein length : | 418 amino acids |
Molecular Weight : | 72.050kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGV VLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLF VANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIP PNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHK RNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLE ASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYAD ICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLAN NREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVS YKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEP PHREVPENETPVDTNLIELDTNDDDIVFEDFARQRLKGMK DDKEEEEDGTGSPQLNNR |
Sequence Similarities : | Belongs to the arrestin family. |
Gene Name : | ARRB1 arrestin, beta 1 [ Homo sapiens ] |
Official Symbol : | ARRB1 |
Synonyms : | ARRB1; arrestin, beta 1; ARR1; beta-arrestin-1; arrestin 2; |
Gene ID : | 408 |
mRNA Refseq : | NM_004041 |
Protein Refseq : | NP_004032 |
MIM : | 107940 |
Uniprot ID : | P49407 |
Chromosome Location : | 11q13 |
Pathway : | CXCR3-mediated signaling events, organism-specific biosystem; Calcium Regulation in the Cardiac Cell, organism-specific biosystem; Chemokine signaling pathway, organism-specific biosystem; Chemokine signaling pathway, conserved biosystem; Clathrin derived vesicle budding, organism-specific biosystem; |
Function : | GTPase activator activity; angiotensin receptor binding; enzyme inhibitor activity; NOT histone acetyltransferase activity; insulin-like growth factor receptor binding; |
Products Types
◆ Recombinant Protein | ||
ARRB1-458R | Recombinant Rat ARRB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ARRB1-753M | Recombinant Mouse ARRB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Arrb1-430M | Recombinant Mouse Arrb1 Protein, MYC/DDK-tagged | +Inquiry |
ARRB1-802R | Recombinant Rat ARRB1 Protein | +Inquiry |
ARRB1-26620TH | Recombinant Human ARRB1 | +Inquiry |
◆ Lysates | ||
ARRB1-8679HCL | Recombinant Human ARRB1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (7)
Ask a questionTargeting ARRB1 or its associated signaling pathways holds potential therapeutic implications for various diseases. Since ARRB1 is involved in regulating GPCR signaling, modulating its activity may provide a means to selectively enhance or reduce the signaling of specific GPCRs. This could be relevant in the treatment of diseases where dysregulated GPCR signaling is implicated, such as certain types of cancer, neurodegenerative disorders, and cardiovascular diseases.
Dysregulation of ARRB1 can lead to altered GPCR signaling and contribute to various diseases, including cardiovascular disorders, cancer, and neurological disorders.
ARRB1 is expressed in a wide range of tissues and organs, including the brain, heart, liver, kidneys, lungs, and immune cells.
ARRB1 binds to phosphorylated GPCRs, which occurs when GPCRs are activated by ligand binding. This binding helps recruit other proteins involved in the desensitization and internalization of the receptor.
ARRB1 has emerged as a potential target for drug development due to its involvement in various diseases. Modulating ARRB1 activity could offer opportunities for developing novel therapeutics aiming to fine-tune GPCR signaling and related pathways.
ARRB1 interacts with various other proteins, including clathrin, which facilitates receptor endocytosis, and signaling molecules such as kinases and phosphatases, which mediate downstream signaling events.
In addition to its role in GPCR regulation, ARRB1 has been implicated in intracellular signaling pathways, including mitogen-activated protein kinase (MAPK) signaling, cell migration, and regulation of gene transcription.
Customer Reviews (3)
Write a reviewIt demonstrates excellent performance in ELISA, consistently delivering accurate and reliable results.
I highly recommend the ARRB1 protein for a variety of research applications.
Great performance in ELISA.
Ask a Question for All ARRB1 Products
Required fields are marked with *
My Review for All ARRB1 Products
Required fields are marked with *
Inquiry Basket