Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human ARRB1

Cat.No. : ARRB1-26622TH
Product Overview : Recombinant full length Human beta Arrestin 1 with N terminal proprietary tag; Predicted MWt 72.05 kDa.
  • Specification
  • Gene Information
  • Related Products
Description : Members of arrestin/beta-arrestin protein family are thought to participate in agonist-mediated desensitization of G-protein-coupled receptors and cause specific dampening of cellular responses to stimuli such as hormones, neurotransmitters, or sensory signals. Arrestin beta 1 is a cytosolic protein and acts as a cofactor in the beta-adrenergic receptor kinase (BARK) mediated desensitization of beta-adrenergic receptors. Besides the central nervous system, it is expressed at high levels in peripheral blood leukocytes, and thus the BARK/beta-arrestin system is believed to play a major role in regulating receptor-mediated immune functions. Alternatively spliced transcripts encoding different isoforms of arrestin beta 1 have been described.
Protein length : 418 amino acids
Molecular Weight : 72.050kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGV VLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLF VANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIP PNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHK RNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLE ASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYAD ICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLAN NREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVS YKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEP PHREVPENETPVDTNLIELDTNDDDIVFEDFARQRLKGMK DDKEEEEDGTGSPQLNNR
Sequence Similarities : Belongs to the arrestin family.
Gene Name : ARRB1 arrestin, beta 1 [ Homo sapiens ]
Official Symbol : ARRB1
Synonyms : ARRB1; arrestin, beta 1; ARR1; beta-arrestin-1; arrestin 2;
Gene ID : 408
mRNA Refseq : NM_004041
Protein Refseq : NP_004032
MIM : 107940
Uniprot ID : P49407
Chromosome Location : 11q13
Pathway : CXCR3-mediated signaling events, organism-specific biosystem; Calcium Regulation in the Cardiac Cell, organism-specific biosystem; Chemokine signaling pathway, organism-specific biosystem; Chemokine signaling pathway, conserved biosystem; Clathrin derived vesicle budding, organism-specific biosystem;
Function : GTPase activator activity; angiotensin receptor binding; enzyme inhibitor activity; NOT histone acetyltransferase activity; insulin-like growth factor receptor binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (7)

Ask a question
What are the potential therapeutic implications of targeting ARRB1? 11/29/2022

Targeting ARRB1 or its associated signaling pathways holds potential therapeutic implications for various diseases. Since ARRB1 is involved in regulating GPCR signaling, modulating its activity may provide a means to selectively enhance or reduce the signaling of specific GPCRs. This could be relevant in the treatment of diseases where dysregulated GPCR signaling is implicated, such as certain types of cancer, neurodegenerative disorders, and cardiovascular diseases.

What are the implications of ARRB1 malfunction or dysregulation? 09/13/2022

Dysregulation of ARRB1 can lead to altered GPCR signaling and contribute to various diseases, including cardiovascular disorders, cancer, and neurological disorders.

In which tissues or organs is ARRB1 expressed? 10/15/2021

ARRB1 is expressed in a wide range of tissues and organs, including the brain, heart, liver, kidneys, lungs, and immune cells.

How does ARRB1 interact with GPCRs? 11/17/2020

ARRB1 binds to phosphorylated GPCRs, which occurs when GPCRs are activated by ligand binding. This binding helps recruit other proteins involved in the desensitization and internalization of the receptor.

Can ARRB1 be targeted for therapeutic interventions? 05/07/2020

ARRB1 has emerged as a potential target for drug development due to its involvement in various diseases. Modulating ARRB1 activity could offer opportunities for developing novel therapeutics aiming to fine-tune GPCR signaling and related pathways.

Are there any known interacting proteins or partners of ARRB1? 06/20/2016

ARRB1 interacts with various other proteins, including clathrin, which facilitates receptor endocytosis, and signaling molecules such as kinases and phosphatases, which mediate downstream signaling events.

Are there any other functions or roles of ARRB1? 01/02/2016

In addition to its role in GPCR regulation, ARRB1 has been implicated in intracellular signaling pathways, including mitogen-activated protein kinase (MAPK) signaling, cell migration, and regulation of gene transcription.

Customer Reviews (3)

Write a review
Reviews
11/17/2022

    It demonstrates excellent performance in ELISA, consistently delivering accurate and reliable results.

    08/20/2017

      I highly recommend the ARRB1 protein for a variety of research applications.

      10/02/2016

        Great performance in ELISA.

        Ask a Question for All ARRB1 Products

        Required fields are marked with *

        My Review for All ARRB1 Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /

        Stay Updated on the Latest Bioscience Trends