"ASL" Related Products

Expand
Expand

Recombinant Human ASL, His-tagged

Cat.No.: ASL-26277TH
Product Overview: Recombinant full length Human Argininosuccinate Lyase with an N terminal His tag 53.8 kDa.
Description: This gene encodes a member of the lyase 1 family. The encoded protein forms a cytosolic homotetramer and primarily catalyzes the reversible hydrolytic cleavage of argininosuccinate into arginine and fumarate, an essential step in the liver in detoxifying ammonia via the urea cycle. Mutations in this gene result in the autosomal recessive disorder argininosuccinic aciduria, or argininosuccinic acid lyase deficiency. A nontranscribed pseudogene is also located on the long arm of chromosome 22. Alternatively spliced transcript variants encoding different isoforms have been described.
Protein length: 464 amino acids
Conjugation: HIS
Molecular Weight: 53.800kDa inclusive of tags
Source: E. coli
Form: Liquid
Purity: >95% by SDS-PAGE
Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 0.04% DTT, 10% Glycerol, 0.58% Sodium chloride
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMASESGKLWGGRFVGAVDPIMEKFNASIAYDRHLWEVDVQGSKAYSRGLEKAGLLTKAEMDQILHGLDKVAEEWAQGTFKLNSNDEDIHTANERRLKELIGATAGKLHTGRSRNDQVVTDLRLWMRQTCSTLSGLLWELIRTMVDRAEAERDVLFPGYTHLQRAQPIRWSHWILSHAVALTRDSERLLEVRKRINVLPLGSGAIAGNPLGVDRELLRAELNFGAITLNSMDATSERDFVAEFLFWASLCMTHLSRMAEDLILYCTKEFSFVQLSDAYSTGSSLMPQKKNPDSLELIRSKAGRVFGRCAGLLMTLKGLPSTYNKDLQEDKEAVFEVSDTMSAVLQVATGVISTLQIHQENMGQALSPDMLATDLAYYLVRKGMPFRQAHEASGKAVFMAETKGVALNQLSLQELQTISPLFSGDVICVWDYGHSVEQYGALGGTARSSVDWQIRQVRALLQAQQA
Sequence Similarities: Belongs to the lyase 1 family. Argininosuccinate lyase subfamily.
Gene Name: ASL argininosuccinate lyase [ Homo sapiens ]
Official Symbol: ASL
Synonyms: ASL; argininosuccinate lyase;
Gene ID: 435
mRNA Refseq: NM_000048
Protein Refseq: NP_000039
MIM: 608310
Uniprot ID: P04424
Chromosome Location: 7q11.21
Pathway: Alanine and aspartate metabolism, organism-specific biosystem; Alanine, aspartate and glutamate metabolism, organism-specific biosystem; Alanine, aspartate and glutamate metabolism, conserved biosystem; Arginine and proline metabolism, organism-specific biosystem; Arginine and proline metabolism, conserved biosystem;
Function: argininosuccinate lyase activity; argininosuccinate lyase activity; catalytic activity; lyase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.