"BSG" Related Products

Expand
Expand
Expand

Recombinant Human BSG

Cat.No.: BSG-27219TH
Product Overview: Recombinant full length Human CD147, isoform 2 (amino acids 1-269) with N terminal proprietary tag, 55.66kDa inclusive of tag.
Description: The protein encoded by this gene is a plasma membrane protein that is important in spermatogenesis, embryo implantation, neural network formation, and tumor progression. The encoded protein is also a member of the immunoglobulin superfamily. Multiple transcript variants encoding different isoforms have been found for this gene.
Protein length: 269 amino acids
Molecular Weight: 55.660kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Present only in vascular endothelium in non-neoplastic regions of the brain, whereas it is present in tumor cells but not in proliferating blood vessels in malignant gliomas.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MAAALFVLLGFALLGTHGASGAAGTVFTTVEDLGSKILLT CSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDD QWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGE TAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFV SSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITL RVRSHLAALWPFLGIVAEVLVLVTIIFIYEKRRKPEDVLD DDDAGSAPLKSSGQHQNDKGKNVRQRNSS
Sequence Similarities: Contains 1 Ig-like C2-type (immunoglobulin-like) domain.Contains 1 Ig-like V-type (immunoglobulin-like) domain.
Gene Name: BSG basigin (Ok blood group) [ Homo sapiens ]
Official Symbol: BSG
Synonyms: BSG; basigin (Ok blood group); basigin (OK blood group) , OK; basigin; CD147; EMMPRIN;
Gene ID: 682
mRNA Refseq: NM_001728
Protein Refseq: NP_001719
MIM: 109480
Uniprot ID: P35613
Chromosome Location: 19p13.3
Pathway: Basigin interactions, organism-specific biosystem; Cell surface interactions at the vascular wall, organism-specific biosystem; Hemostasis, organism-specific biosystem; Integrin cell surface interactions, organism-specific biosystem; Matrix Metalloproteinases, organism-specific biosystem;
Function: lactate transmembrane transporter activity; mannose binding; sugar binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.