"CA6" Related Products

Expand
Expand

Recombinant Human CA6

Cat.No.: CA6-26132TH
Product Overview: Recombinant full length Human CA6 with a N terminal proprietary tag; Predicted MWt 59.95 kDa.
Description: The protein encoded by this gene is one of several isozymes of carbonic anhydrase. This protein is found only in salivary glands and saliva and protein may play a role in the reversible hydratation of carbon dioxide though its function in saliva is unknown.
Protein length: 308 amino acids
Molecular Weight: 59.950kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Major constituent of saliva.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MRALVLLLSLFLLGGQAQHVSDWTYSEGALDEAHWPQH YPACGGQRQSPINLQRTKVRYNPSLKGLNMTGYETQAGEF PMVNNGHTVQISLPSTMRMTVADGTVYIAQQMHFHWGGAS SEISGSEHTVDGIRHVIEIHIVHYNSKYKSYDIAQDAPDG LAVLAAFVEVKNYPENTYYSNFISHLANIKYPGQRTTLTG LDVQDMLPRNLQHYYTYHGSLTTPPCTENVHWFVLADFVK LSRTQVWKLENSLLDHRNKTIHNDYRRTQPLNHRVVESNF PNQEYTLGSEFQFYLHKIEEILDYLRRALN
Sequence Similarities: Belongs to the alpha-carbonic anhydrase family.
Gene Name: CA6 carbonic anhydrase VI [ Homo sapiens ]
Official Symbol: CA6
Synonyms: CA6; carbonic anhydrase VI; carbonic anhydrase 6;
Gene ID: 765
mRNA Refseq: NM_001215
Protein Refseq: NP_001206
MIM: 114780
Uniprot ID: P23280
Chromosome Location: 1p36.2
Pathway: Nitrogen metabolism, organism-specific biosystem; Nitrogen metabolism, conserved biosystem;
Function: carbonate dehydratase activity; lyase activity; metal ion binding; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.