"CCL17" Related Products

Expand
Expand

Recombinant Human CCL17

Cat.No.: CCL17-30148TH
Product Overview: Highly pure (>98%) recombinant human TARC.
Description: This gene is one of several Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 16. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for T lymphocytes, but not monocytes or granulocytes. The product of this gene binds to chemokine receptors CCR4 and CCR8. This chemokine plays important roles in T cell development in thymus as well as in trafficking and activation of mature T cells.
Source: E. coli
Tissue specificity: Expressed at high levels in thymus and at low levels in the lung, colon and small intestine.
Form: Lyophilised:Please reconstitute this product in 200ul water.
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: Human TARC is an 8.0 kDa protein containing 71 amino acid residues:ARGTNVGRECCLEYFKGAIPLRKLK TWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAV KYLQSLERS
Sequence Similarities: Belongs to the intercrine beta (chemokine CC) family.
Gene Name: CCL17 chemokine (C-C motif) ligand 17 [ Homo sapiens ]
Official Symbol: CCL17
Synonyms: CCL17; chemokine (C-C motif) ligand 17; SCYA17, small inducible cytokine subfamily A (Cys Cys), member 17; C-C motif chemokine 17; ABCD 2; TARC;
Gene ID: 6361
mRNA Refseq: NM_002987
Protein Refseq: NP_002978
MIM: 601520
Uniprot ID: Q92583
Chromosome Location: 16q13
Pathway: Chemokine receptors bind chemokines, organism-specific biosystem; Chemokine signaling pathway, organism-specific biosystem; Chemokine signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem;
Function: chemokine activity; receptor binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.