Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human CCL22

Cat.No. : CCL22-29602TH
Product Overview : Highly pure (>98%) recombinant human MDC.
  • Specification
  • Gene Information
  • Related Products
Description : This gene is one of several Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 16. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for monocytes, dendritic cells, natural killer cells and for chronically activated T lymphocytes. It also displays a mild activity for primary activated T lymphocytes and has no chemoattractant activity for neutrophils, eosinophils and resting T lymphocytes.The product of this gene binds to chemokine receptor CCR4. This chemokine may play a role in the trafficking of activated T lymphocytes to inflammatory sites and other aspects of activated T lymphocyte physiology.
Source : E. coli
Tissue specificity : Highly expressed in macrophage and in monocyte-derived dendritic cells, and thymus. Also found in lymph node, appendix, activated monocytes, resting and activated macrophages. Lower expression in lung and spleen. Very weak expression in small intestine. I
Form : Lyophilised:Reconstitute in water to a concentration of 0.1mg/ml.
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : Human MDC is an 8.1 kDa protein containing 69 amino acid residues.The 69 amino acid form of MDC contains a Glycine and Proline at the N-terminus:GPYGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSCPRPGVVLLTF RDKEICADPRVPWVKMILNKLSQ
Sequence Similarities : Belongs to the intercrine beta (chemokine CC) family.
Gene Name : CCL22 chemokine (C-C motif) ligand 22 [ Homo sapiens ]
Official Symbol : CCL22
Synonyms : CCL22; chemokine (C-C motif) ligand 22; SCYA22, small inducible cytokine subfamily A (Cys Cys), member 22; C-C motif chemokine 22; A 152E5.1; ABCD 1; DC/B CK; MDC; MGC34554; STCP 1;
Gene ID : 6367
mRNA Refseq : NM_002990
Protein Refseq : NP_002981
MIM : 602957
Uniprot ID : O00626
Chromosome Location : 16q13
Pathway : Chemokine receptors bind chemokines, organism-specific biosystem; Chemokine signaling pathway, organism-specific biosystem; Chemokine signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem;
Function : chemokine activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (6)

Ask a question
What are the gene expression regulatory mechanisms of CCL22 protein? 11/23/2019

The expression of CCL22 gene is regulated by a variety of signaling pathways, including inflammatory factor-mediated signaling pathways, cytokine-mediated signaling pathways, and transcription factors.

What is the potential application value of CCL22 protein in treatment? 09/30/2019

Studies have shown that by interfering with the interaction of the CCL22 protein and its receptor CCR4, tumor growth, improve inflammatory response, and regulate autoimmune diseases can be inhibited. These findings provide potential application value for the development of corresponding therapeutic strategies.

Are there inhibitors or antagonists that interact with the CCL22 protein? 08/04/2019

A number of inhibitors or antagonists that interact with CCL22 proteins have been developed that block the binding of CCL22 to its receptor CCR4, thereby interfering with its biological function.

How to study the mechanism of action of CCL22 protein in specific diseases? 06/02/2019

The mechanism of action of CCL22 protein in specific diseases can be studied through cell culture experiments, animal models, clinical samples, and related biochemical techniques.

How does the CCL22 protein relate to other chemokines? 04/10/2019

There are complex interactions between CCL22 proteins and other chemokines. They may influence the migration and localization of immune cells by competing for receptors, mutual regulation of expression, etc.

What is the role of CCL22 protein in tumor immunotherapy? 03/08/2019

Some studies have shown that in tumor immunotherapy, inhibiting the expression of CCL22 or interfering with its interaction with CCR4 can enhance the effect of immunotherapy and improve the survival rate of patients.

Customer Reviews (3)

Write a review
Reviews
05/01/2022

    The catalytic activity of CCL22 is very strong, which can significantly improve the selectivity and yield of chemical reactions, and has high application value.

    03/13/2022

      This repeatability of CCL22 is very good, which can ensure the safety of the experiment and avoid unnecessary risks.

      08/25/2019

        CCL22 were well suited for our research needs due to their simple storage conditions and long-term preservation.

        Ask a Question for All CCL22 Products

        Required fields are marked with *

        My Review for All CCL22 Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /

        Stay Updated on the Latest Bioscience Trends