Recombinant Human CCNG1
Cat.No. : | CCNG1-28189TH |
Product Overview : | Recombinant full length Human Cyclin G with N terminal proprietary tag; Predicted MWt 58.52 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
Description : | The eukaryotic cell cycle is governed by cyclin-dependent protein kinases (CDKs) whose activities are regulated by cyclins and CDK inhibitors. The protein encoded by this gene is a member of the cyclin family and contains the cyclin box. The encoded protein lacks the protein destabilizing (PEST) sequence that is present in other family members. Transcriptional activation of this gene can be induced by tumor protein p53. Two transcript variants encoding the same protein have been identified for this gene. |
Protein length : | 295 amino acids |
Molecular Weight : | 58.520kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | High levels in skeletal muscle, ovary, kidney and colon. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MIEVLTTTDSQKLLHQLNALLEQESRCQPKVCGLRLIESA HDNGLRMTARLRDFEVKDLLSLTQFFGFDTETFSLAVNLL DRFLSKMKVQPKHLGCVGLSCFYLAVKSIEEERNVPLATD LIRISQYRFTVSDLMRMEKIVLEKVCWKVKATTAFQFLQL YYSLLQENLPLERRNSINFERLEAQLKACHCRIIFSKAKP SVLALSIIALEIQAQKCVELTEGIECLQKHSKINGRDLTF WQELVSKCLTEYSSNKCSKPNVQKLKWIVSGRTARQLKHS YYRITHLPTIPEMVP |
Sequence Similarities : | Belongs to the cyclin family. Cyclin G subfamily. |
Gene Name : | CCNG1 cyclin G1 [ Homo sapiens ] |
Official Symbol : | CCNG1 |
Synonyms : | CCNG1; cyclin G1; CCNG; cyclin-G1; |
Gene ID : | 900 |
mRNA Refseq : | NM_004060 |
Protein Refseq : | NP_004051 |
MIM : | 601578 |
Uniprot ID : | P51959 |
Chromosome Location : | 5q32-q34 |
Pathway : | Direct p53 effectors, organism-specific biosystem; p53 pathway, organism-specific biosystem; p53 signaling pathway, organism-specific biosystem; p53 signaling pathway, conserved biosystem; |
Function : | protein domain specific binding; |
Products Types
◆ Recombinant Protein | ||
CCNG1-882R | Recombinant Rat CCNG1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCNG1-0669H | Recombinant Human CCNG1 Protein, GST-Tagged | +Inquiry |
CCNG1-1408M | Recombinant Mouse CCNG1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCNG1-3613H | Recombinant Human CCNG1 protein, GST-tagged | +Inquiry |
CCNG1-9922Z | Recombinant Zebrafish CCNG1 | +Inquiry |
◆ Lysates | ||
CCNG1-7707HCL | Recombinant Human CCNG1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket